DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and Mpcp2

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:351 Identity:77/351 - (21%)
Similarity:141/351 - (40%) Gaps:62/351 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 STAFMTPSRLAENAGGGPANGGQSELLRPEQRRKL--STTILRNRSQPQVIGGVR-----RIMAI 96
            ::.|.||..:|......|....|     |.:.|::  :.|.:.|:......|..:     .|..|
  Fly    11 NSPFRTPMSMARCDAAAPVVEPQ-----PVEGRQIAAAATPVANQQDSCEFGSTKYFALCGIGGI 70

  Fly    97 SHCGISSTTPKSMSIVQCLRHI---------------VQNEGPRALFKGLGPNLVGVAPSRAIYF 146
            ..||.:.|....:.:|:|...:               |..||.|.|.||..|.|:|.:......|
  Fly    71 LSCGTTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKF 135

  Fly   147 CTYSQTKNTLNSL-----GFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQL--DYNSKVQ 204
            ..|...|.....:     .::.|.|  :::.::|||.|.:..|..|....|.::|.  .|.:   
  Fly   136 GLYELFKVKYAEIIGEENAYLYRTS--LYLAASASAEFFADIALAPFEAAKVKIQTIPGYAN--- 195

  Fly   205 MTVRQCIERVYAQGGVAAFYKGITASYF-GICETMVHF--------VIYEFIKSKLLEQRNQRHT 260
             ..|:.:.::..:.||.|||||:...:. .|..||:.|        ::|:::..|      .|..
  Fly   196 -NFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPK------PRAD 253

  Fly   261 DTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYNSFWQTLHTVWKEEGRAGLYRG 325
            .|||.:..:.| .||.::....:.:::|.:|..::|.:...      .:..:|.|..|.:|::.|
  Fly   254 CTKGEQLIVTF-AAGYIAGVFCAVVSHPADVVVSKLNQAKG------ASAISVAKSLGFSGMWNG 311

  Fly   326 LATQLVRQIPNTAIMMATYEAVVYVL 351
            |..:::.....||:....|:.|...|
  Fly   312 LTPRIIMIGTLTALQWFIYDGVKVAL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 31/138 (22%)
Mito_carr 163..253 CDD:278578 25/100 (25%)
Mito_carr 268..355 CDD:278578 17/84 (20%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 19/83 (23%)
Mito_carr <175..245 CDD:278578 18/73 (25%)
Mito_carr 260..338 CDD:278578 17/85 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.