DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and slc25a32a

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_956550.1 Gene:slc25a32a / 393226 ZFINID:ZDB-GENE-040426-758 Length:324 Species:Danio rerio


Alignment Length:350 Identity:87/350 - (24%)
Similarity:143/350 - (40%) Gaps:68/350 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 HLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLST 75
            :|.||.:.|.:..:|..||:::|.|...|...                                 
Zfish    39 NLAAGLAGGVISTMVLHPLDLIKIRFAVSDGL--------------------------------- 70

  Fly    76 TILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAP 140
                 :.:||..|                      ::.|::.|.:.||.|.|::|:.||:.|...
Zfish    71 -----KMRPQYDG----------------------MLDCMKTIWKLEGIRGLYQGVTPNIWGAGS 108

  Fly   141 SRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQLDYNS---- 201
            |..:||..|:..| .....|.....|...|::|||.||.::...|||:|..|||:.|.||:    
Zfish   109 SWGLYFLFYNAIK-AY
TQEGRQTELSACEHLVSAAEAGILTLCLTNPVWVTKTRLVLQYNADPSR 172

  Fly   202 KVQMTVRQCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRNQRHTDTKGSR 266
            |....:...:.::|...|:...|:|......|.....:.|:.||.:|.   ||...:...::...
Zfish   173 KQYKGMMDALVKIYRHEGIPGLYRGFVPGLVGTSHAALQFMTYEGLKR---EQNKCKKMPSESLL 234

  Fly   267 DFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYNSFWQTLHTVWKEEGRAGLYRGLATQLV 331
            ..||::...|:||..|..:.||::|.|.||:::.|.|:.....:...|..||..|.|:|:...||
Zfish   235 SPLEYIAIAAISKIFAVAVTYPYQVVRARLQDQHNNYSGIVDVMRRTWSNEGVEGFYKGMVPNLV 299

  Fly   332 RQIPNTAIMMATYEAVVYVLTRRFN 356
            |.||...|....:|.|..:|...::
Zfish   300 RVIPACCITFLVFENVSRLLLGEYH 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 28/144 (19%)
Mito_carr 163..253 CDD:278578 27/93 (29%)
Mito_carr 268..355 CDD:278578 29/86 (34%)
slc25a32aNP_956550.1 Mito_carr 37..123 CDD:278578 28/144 (19%)
Mito_carr 131..220 CDD:278578 26/88 (30%)
Mito_carr 234..323 CDD:278578 29/88 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoDB 1 1.010 - - D404957at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.