DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and Bmcp

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:361 Identity:88/361 - (24%)
Similarity:129/361 - (35%) Gaps:101/361 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKL--ST 75
            :.||.|.......|.|::..|||||.                              |.:|:  |.
  Fly    11 VYGGVASITAEFGTFPIDTTKTRLQI------------------------------QGQKIDQSF 45

  Fly    76 TILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAP 140
            :.||.|                  |::....|          |.:.||.|||:.|:.|.::..|.
  Fly    46 SQLRYR------------------GMTDAFVK----------ISREEGLRALYSGIWPAVLRQAT 82

  Fly   141 SRAIYFCTYSQTKNTLNSLGFV--ERDSPLV--HIMSAASAGFVSSTATNPIWFVKTRMQLDYNS 201
            ...|.|.||...|...|..|.:  |..|..|  :|:.||:||.:||...||...:|.|||: :..
  Fly    83 YGTIKFGTYYTLKKL
ANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVRMQV-HGK 146

  Fly   202 KVQMTVRQCIERVYAQGGVAAFYKGI--TASYFGICETMVHFVIYEFIKSKLLEQRNQRHTDTKG 264
            .....:..|...:|...||...::|:  ||.. .:....|...:|:|.|.:|:    ....|..|
  Fly   147 GQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQR-AVVIASVELPVYDFCKLQLM----NAFGDHVG 206

  Fly   265 SRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREE--------------------GNKYNSFWQT 309
            :.....|:  .::...|||.   |.:|.||||..:                    ....:...||
  Fly   207 NHFISSFI--ASLGSAIAST---PIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQT 266

  Fly   310 LHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYE 345
            :    :.||...||:|.....||..|...|...|||
  Fly   267 I----RNEGLPALYKGFIPTWVRMGPWNIIFFITYE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 32/144 (22%)
Mito_carr 163..253 CDD:278578 28/93 (30%)
Mito_carr 268..355 CDD:278578 24/98 (24%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 32/143 (22%)
Mito_carr <132..199 CDD:278578 18/72 (25%)
Mito_carr 204..303 CDD:278578 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.