DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and CG7514

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:369 Identity:81/369 - (21%)
Similarity:124/369 - (33%) Gaps:119/369 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTTI 77
            |.||.||.:|..:..||::||||:|                                        
  Fly    17 INGGLAGMLGTCIVQPLDLVKTRMQ---------------------------------------- 41

  Fly    78 LRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPSR 142
                                   ||:||.:..|...||..:.:|||..||:.||...|:..|   
  Fly    42 -----------------------ISATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQA--- 80

  Fly   143 AIYFCTYSQTKNTLNSLGFVERD------------SPLVHIMSAASAGFVSSTATNPIWFVKTRM 195
                 ||:..:     :||.:.:            :.|..:.....||...:...||......||
  Fly    81 -----TYTTAR-----MGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRM 135

  Fly   196 QLD----------YNSKVQMTVRQCIERVYAQGGVAAFYKGITASY-FGICETMVHFVIYEFIKS 249
            ..|          |..     |.....|:....||...:||...:. ..:...||....|..:|:
  Fly   136 MSDNRLPPAERRNYTG-----VLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKA 195

  Fly   250 KLLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGN-KYNSFWQTLHTV 313
            ...|..:..      |......||:|.:: ||||   .|.::|:||::::.. :|......|..|
  Fly   196 AFSEYFSGL------SLHIAAAMMSGLLT-TIAS---MPLDMAKTRIQQQKTAEYKGTMDVLMKV 250

  Fly   314 WKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAVVYVLTRRFNN 357
            .|.||.|.|::|....|.|..|:|.......|.    ||:.:.:
  Fly   251 SKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQ----LTKAYKH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 31/142 (22%)
Mito_carr 163..253 CDD:278578 19/112 (17%)
Mito_carr 268..355 CDD:278578 27/87 (31%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 81/364 (22%)
Mito_carr 19..90 CDD:278578 31/146 (21%)
Mito_carr 104..201 CDD:278578 20/101 (20%)
Mito_carr 207..284 CDD:278578 25/84 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.