DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and Tpc2

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:366 Identity:71/366 - (19%)
Similarity:137/366 - (37%) Gaps:88/366 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKL 73
            |:..:.||.||.....:|.||:|:|.|.|.....:|                             
  Fly    10 LMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVT----------------------------- 45

  Fly    74 STTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGV 138
                                   :|.|     .|...::...:.:...||.|.:|:|.....|..
  Fly    46 -----------------------NHKG-----SKYRGVIHAFKSVYAEEGMRGMFRGHNSGQVLS 82

  Fly   139 APSRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRM-QLDYNS- 201
            .....:.|.:|.|.::..:...:......|:..:....||.:.:.|..|...|:|:| ..|.:| 
  Fly    83 ISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQMVAADPSSR 147

  Fly   202 KVQMTVRQCIERVYAQGGVAAFYKGITASYFGICETM-VHFVIYEFIKSKLL-----EQRNQRHT 260
            :.||.....:.:||...|.....:|:..:...:...: .:|:.|:::.:.:|     :||.:.| 
  Fly   148 RSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPDQRQEIH- 211

  Fly   261 DTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRL-----REEGNKYN------SFWQTLHTVW 314
               |:..||.    ||:|..:|..|.||.::.:.|:     ::|...:.      :....:.|.:
  Fly   212 ---GAFLFLN----GALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILGCITTTF 269

  Fly   315 KEEGRAGLYRGLATQLVRQIPNTAIMMATYEAVVYVLTRRF 355
            :|||..|.|:|:...|::    ..:|.|.|.::..:..|.:
  Fly   270 REEGIGGFYKGMLPTLLK----AGLMSAVYFSIYDMFKRHY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 25/146 (17%)
Mito_carr 163..253 CDD:278578 19/97 (20%)
Mito_carr 268..355 CDD:278578 23/97 (24%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 65/349 (19%)
Mito_carr 23..99 CDD:278578 20/132 (15%)
Mito_carr 108..194 CDD:278578 18/85 (21%)
Mito_carr 216..307 CDD:278578 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.