DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and Mpcp1

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:363 Identity:85/363 - (23%)
Similarity:145/363 - (39%) Gaps:78/363 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAEN---AGGGPANGGQSELLRPEQRRKLSTTIL 78
            ||.|..||||..|:.|           .|.:|..|   |....|.|...|.              
  Fly    30 SAPTSTAVVTPTLKDV-----------APRQLTRNHNIAAAAVAEGDSCEF-------------- 69

  Fly    79 RNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQC---------------LRHIVQNEGPRALF 128
             ..:...::.|:..|::   ||.:.|....:.:|:|               .|..:..||.|.|.
  Fly    70 -GSNHYFLLCGLGGIIS---CGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEEGVRGLA 130

  Fly   129 KGLGPNLVGVAPSRAIYFCTYSQTKNTL-NSLG----FVERDSPLVHIMSAASAGFVSSTATNPI 188
            ||..|..:|.:......|..|...|... :::|    |:.|..  :::.::|||.|.:..|..|:
  Fly   131 KGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTG--LYLAASASAEFFADIALAPM 193

  Fly   189 WFVKTRMQLDYNSKVQMTVRQCIERVYAQGGVAAFYKGITASYF-GICETMVHF--------VIY 244
            ...|.::|.  ......|:|:.:.::.||.||.|||||:...:. .|..||:.|        ::|
  Fly   194 EAAKVKIQT--TPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLY 256

  Fly   245 EFIKSKLLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYNSFWQT 309
            :::..|      .|...|||.:..:.| .||.::....:.:::|.:...::|.:...      .:
  Fly   257 KYVVPK------PRADCTKGEQLVVTF-AAGYIAGVFCAIVSHPADTVVSKLNQAKG------AS 308

  Fly   310 LHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAV 347
            ...|.|:.|.:||:.||..::|.....||.....|:||
  Fly   309 ALDVAKQLGWSGLWGGLVPRIVMIGTLTAAQWFIYDAV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 35/156 (22%)
Mito_carr 163..253 CDD:278578 26/98 (27%)
Mito_carr 268..355 CDD:278578 18/80 (23%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 19/91 (21%)
Mito_carr <188..258 CDD:278578 20/71 (28%)
Mito_carr 273..350 CDD:278578 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.