DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and Slc25a36l1

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_038954017.1 Gene:Slc25a36l1 / 364991 RGDID:1561851 Length:316 Species:Rattus norvegicus


Alignment Length:358 Identity:178/358 - (49%)
Similarity:221/358 - (61%) Gaps:56/358 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQNTADTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELL 65
            |:|.  |||:||.|||..|||||::||||||||||||||:..:..|.:..|.             
  Rat     6 MSQR--DTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNT------------- 55

  Fly    66 RPEQRRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKG 130
                               .....|.|::             |...:.||:.|::.||||:||:|
  Rat    56 -------------------MAEASVNRVV-------------SPGPLHCLKVILEKEGPRSLFRG 88

  Fly   131 LGPNLVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRM 195
            ||||||||||||||||..||..|..||  |..:.||..||::|||.|||.:.|||||||.:|||:
  Rat    89 LGPNLVGVAPSRAIYFAAYSNCKEKLN--GVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRL 151

  Fly   196 QLDYNSK--VQMTVRQCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRNQR 258
            |||..::  .:|...:|:.:||...|:..||:|::|||.||.||::||||||.||.||||.:...
  Rat   152 QLDARNRGEKRMGAFECVRKVYQTDGLRGFYRGMSASYAGISETVIHFVIYESIKQKLLECKTAS 216

  Fly   259 HTDT-----KGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYNSFWQTLHTVWKEEG 318
            ..:|     |.:.||:..|:|.|.|||.|:.|||||||.||||||||.||.||:|||..:.:|||
  Rat   217 MMETDEESVKEASDFVRMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLIVQEEG 281

  Fly   319 RAGLYRGLATQLVRQIPNTAIMMATYEAVVYVL 351
            ...|||||.|.||||||||||||||||.|||:|
  Rat   282 YGSLYRGLTTHLVRQIPNTAIMMATYELVVYLL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 60/147 (41%)
Mito_carr 163..253 CDD:278578 48/91 (53%)
Mito_carr 268..355 CDD:278578 59/84 (70%)
Slc25a36l1XP_038954017.1 Mito_carr 7..118 CDD:395101 65/159 (41%)
Mito_carr 119..211 CDD:395101 48/91 (53%)
Mito_carr 231..316 CDD:395101 59/84 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1372287at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.