DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and Dic3

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:181 Identity:48/181 - (26%)
Similarity:81/181 - (44%) Gaps:23/181 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 VSSTATNPIWFVKTRMQLDYNSKVQMTVRQCIERVYAQGGVAAFYKGITASYF-GICETMVHFVI 243
            ::.|.|:||..:|.::|....:. :.||.:.::.::.:.|:..||.||:||:| .:..|...|.:
  Fly    21 IAVTGTHPIDLIKVQLQTQSQAD-RKTVGEILKGIHERSGILGFYNGISASWFRQLTYTTTRFAL 84

  Fly   244 YEFIKSKLLEQRNQRHTDT-KGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLR-------EEG 300
            ||..|.         :.|| |.|........||.|    ...:..|.:|...||:       |:.
  Fly    85 YEAGKD---------YVDTQKVSSKMALATFAGIV----GGIVGVPGDVVTVRLQNDVKLPEEKR 136

  Fly   301 NKYNSFWQTLHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAVVYVL 351
            ..|...:..|..::||||.:.|:||....:.|.:..|....|.|:.|..:|
  Fly   137 RNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQML 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578
Mito_carr 163..253 CDD:278578 21/73 (29%)
Mito_carr 268..355 CDD:278578 23/91 (25%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 48/181 (27%)
Mito_carr 15..91 CDD:278578 21/79 (27%)
Mito_carr 93..187 CDD:278578 26/97 (27%)
Mito_carr 200..281 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441975
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.