DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and CG4995

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:365 Identity:77/365 - (21%)
Similarity:130/365 - (35%) Gaps:105/365 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TADT-----LIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSEL 64
            |::|     ::..:||...|..|.:|..|.:.||..||:.               .|.|      
  Fly    32 TSETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTD---------------DPRN------ 75

  Fly    65 LRPEQRRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFK 129
                                                     ||......|.|.|||.:....|::
  Fly    76 -----------------------------------------PKYKGTFHCFRTIVQRDKFIGLYR 99

  Fly   130 GLGPNLVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTR 194
            |:...:.|:....||.|..|...:...|     :.:|...|..:.:.||........|:...|||
  Fly   100 GISSPMGGIGLVNAIVFGVYGNVQRLSN-----DPNSLTSHFFAGSIAGVAQGFVCAPMELAKTR 159

  Fly   195 MQLDYNSKVQMTVR-----QCIERVYAQGGVAAFYKGITASYF----GICETMVHFVIYEFIKSK 250
            :||  :::|...::     .|::.:....|:...:||:||:..    |...   :||.:|::   
  Fly   160 LQL--STQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFAS---YFVSFEYL--- 216

  Fly   251 LLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREE----GNKYNSFWQTLH 311
                  .|..:|.|   ....:|||..:...:....||.:|.:|.::.:    ..|||.|.....
  Fly   217 ------MRQVETPG---VAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAM 272

  Fly   312 TVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAVVYVL 351
            ..::.||....:|||.:.|:|..|..|   |.:..|.:||
  Fly   273 KGFRNEGPQYFFRGLNSTLIRAFPMNA---ACFFVVSWVL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 27/152 (18%)
Mito_carr 163..253 CDD:278578 21/98 (21%)
Mito_carr 268..355 CDD:278578 24/88 (27%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 26/150 (17%)
PTZ00169 41..295 CDD:240302 69/337 (20%)
Mito_carr 128..218 CDD:278578 21/103 (20%)
Mito_carr 221..304 CDD:278578 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.