DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and MME1

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:336 Identity:77/336 - (22%)
Similarity:121/336 - (36%) Gaps:80/336 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTTI 77
            ||||..|....:|..||:.:|.|||:...              |..|                  
  Fly    19 IAGGVGGMCNVLVGHPLDTIKVRLQTMPT--------------PPPG------------------ 51

  Fly    78 LRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPSR 142
                 ||                     |:...::.|.....:.||.|..::|:...||||.|..
  Fly    52 -----QP---------------------PRYKGVIDCAARTFRYEGFRGFYRGISAPLVGVTPIY 90

  Fly   143 AIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQ--------LDY 199
            |:.|..|:..|....:...:....|.: ..:.|.||..|:..|.|...:|..:|        |.|
  Fly    91 AVDFAVYAAGKRLFQTD
DHIRLTYPQI-FAAGALAGVCSALVTVPTDRIKVLLQTQTVSNGPLLY 154

  Fly   200 NSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRNQRHTDTKG 264
            |..:....     ::|.|||:.:.:||..|.......|..:||.|||:      |...|.....|
  Fly   155 NGTIDTAA-----KLYRQGGIRSLFKGTCACILRDSPTGFYFVTYEFL------QELARKKSANG 208

  Fly   265 SRDFLEFMMAGAVSKTIASCIAYPHEVARTRLRE--EGNKYNSFWQTLHTVWKEEGRAGLYRGLA 327
            .......:::|..:..:...:|.|.:|.::||:.  ||...:........:...||...|:||:.
  Fly   209 KISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVFRNLMATEGPKALFRGIL 273

  Fly   328 TQLVRQIPNTA 338
            ..|:|..|:||
  Fly   274 PILLRAFPSTA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 31/142 (22%)
Mito_carr 163..253 CDD:278578 25/97 (26%)
Mito_carr 268..355 CDD:278578 18/73 (25%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 31/145 (21%)
Mito_carr 111..205 CDD:278578 27/105 (26%)
Mito_carr 208..297 CDD:278578 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441767
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.