DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and Ucp4C

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:379 Identity:82/379 - (21%)
Similarity:135/379 - (35%) Gaps:124/379 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TADTLIHLIAGGSAGTVGAVVTC--PLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRP 67
            ||..|..|......| .....:|  ||:|.|||:|                   .:|        
  Fly    32 TARNLFQLYVNTFIG-ANLAESCVFPLDVAKTRMQ-------------------VDG-------- 68

  Fly    68 EQRRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQC-LRHIVQNEGPRALFKGL 131
            ||.:|                                |.|:|...:. |.::::.||.::|:.|.
  Fly    69 EQAKK--------------------------------TGKAMPTFRATLTNMIRVEGFKSLYAGF 101

  Fly   132 GPNLVGVAPSRAIYFCTYSQTKNTL-NSLGFV-------------ERDSPLVHIMSAA----SAG 178
            ...:                |:|.: |||..|             ||:..::.|..|.    :||
  Fly   102 SAMV----------------TRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAG 150

  Fly   179 FVSSTATNPIWFVKTRM-------QLDYNSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGIC- 235
            .::....||...||.||       ||.|:.:|...|:..:: :|.:||:.:.:||:..|....| 
  Fly   151 CIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVD-IYRRGGLPSMWKGVGPSCMRACL 214

  Fly   236 ETMVHFVIYEFIKSKLLEQRNQRHTDTKGSRD--FLEFMMAGAVSKTIASCIAYPHEVARTRLR- 297
            .|......|:..|...     :|..|.:....  |:..|.||..    ||.::.|.:|.::|:. 
  Fly   215 MTTGDVGSYDISKRTF-----KRLLDLEEGLPLRFVSSMCAGLT----ASVLSTPADVIKSRMMN 270

  Fly   298 ---EEGNK---YNSFWQTLHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYE 345
               :|..|   |.:....:..:.:|||...||:||.....|..|.:.:...:.|
  Fly   271 QPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 25/150 (17%)
Mito_carr 163..253 CDD:278578 27/101 (27%)
Mito_carr 268..355 CDD:278578 22/85 (26%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 26/149 (17%)
Mito_carr 137..232 CDD:278578 25/100 (25%)
Mito_carr 237..329 CDD:278578 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.