DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and Slc25a32

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001166805.1 Gene:Slc25a32 / 315023 RGDID:1565789 Length:316 Species:Rattus norvegicus


Alignment Length:347 Identity:90/347 - (25%)
Similarity:140/347 - (40%) Gaps:70/347 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 HLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLST 75
            :|:||.|.|.:..:...||::||.|...|...                                 
  Rat    25 NLVAGVSGGVLSNLALHPLDLVKIRFAVSDGL--------------------------------- 56

  Fly    76 TILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAP 140
                                       ...||...|:.||..|.:.:|.|.|::|:.||:.|...
  Rat    57 ---------------------------EVRPKYKGILHCLATIWKVDGLRGLYQGVTPNVWGAGL 94

  Fly   141 SRAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQLDYNSKVQM 205
            |..:||..|:..| :..:.|..|:...|.:::|||.||.::...|||:|..|||:.|.|...|..
  Rat    95 SWGLYFFFYNAIK-SYKTEGRAEQLEALEYLISAAEAGAMTLCITNPLWVTKTRLMLQYGGVVNP 158

  Fly   206 TVRQ------CIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRNQRHTDTKG 264
            :.||      .:.::|...||...|||.....||.....:.|:.||.:|.|..:..|:.   .:.
  Rat   159 SQRQYKGMIDALVKIYKYEGVRGLYKGFVPGLFGTSHGALQFMAYEVLKLKYNKHINKL---PEA 220

  Fly   265 SRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYNSFWQTLHTVWKEEGRAGLYRGLATQ 329
            .....|::...|:||..|....||::|.|.||:::...|......:...|::||..|.|:|:|..
  Rat   221 QLSTAEYISVAALSKIFAVAATYPYQVVRARLQDQHVSYGGVTDVITKTWRKEGIGGFYKGIAPN 285

  Fly   330 LVRQIPNTAIMMATYEAVVYVL 351
            |:|..|...|....||.|.:.|
  Rat   286 LIRVTPACCITFVVYENVSHFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 29/144 (20%)
Mito_carr 163..253 CDD:278578 32/95 (34%)
Mito_carr 268..355 CDD:278578 27/84 (32%)
Slc25a32NP_001166805.1 PTZ00169 26..307 CDD:240302 89/344 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoDB 1 1.010 - - D404957at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.