DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and CG5254

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:342 Identity:89/342 - (26%)
Similarity:145/342 - (42%) Gaps:72/342 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTT 76
            ::||||||.:...:..||:|||||:|...   ||:..|...|....||                 
  Fly    18 VLAGGSAGFLEVCIMQPLDVVKTRIQIQA---TPAPNAAALGEVHYNG----------------- 62

  Fly    77 ILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPS 141
                                              :..|...:.::||..:.:||:.|.::...|.
  Fly    63 ----------------------------------VFDCFAKMYRHEGISSYWKGIMPPILAETPK 93

  Fly   142 RAIYFCTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQLDYNSKVQMT 206
            |||.|..:.||| .|...| ....:||...::..:||.:.:.|.||...||...|.|...|:..|
  Fly    94 RAIKFLVFEQTK-PLFQFG-SPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQQADRQKKMLST 156

  Fly   207 VRQCIERVYAQG-GVAAFYKGITASY--FGICETMVHFVIYEFIKSKLLEQRNQRHTDTKGSRDF 268
            .......:...| |.:...|||||:.  .|:. .||:|..|..:|:.:.|.: :.|.      :|
  Fly   157 FAVAKGIIQQDGLGFSGLNKGITATMGRNGVF-NMVYFGFYHSVKNVVPEYK-ESHL------EF 213

  Fly   269 LEFMMAGAVSKTIASCIAYPHEVARTRLR----EEGN-KYNSFWQTLHTVWKEEGRAGLYRGLAT 328
            |..:..|.::.|:|..:..|.:||::|::    ..|. ||.....::..|::|||...||:||..
  Fly   214 LRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIKYRGTLSSMGIVYREEGFRALYKGLVP 278

  Fly   329 QLVRQIPNTAIMMATYE 345
            :::|..|..||::..:|
  Fly   279 KIMRLGPGGAILLLVFE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 34/143 (24%)
Mito_carr 163..253 CDD:278578 26/92 (28%)
Mito_carr 268..355 CDD:278578 25/83 (30%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 36/149 (24%)
PTZ00169 19..301 CDD:240302 89/341 (26%)
Mito_carr 122..207 CDD:278578 25/85 (29%)
Mito_carr 209..305 CDD:278578 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.