DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and SPAC227.03c

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_592957.1 Gene:SPAC227.03c / 2541928 PomBaseID:SPAC227.03c Length:371 Species:Schizosaccharomyces pombe


Alignment Length:427 Identity:117/427 - (27%)
Similarity:163/427 - (38%) Gaps:150/427 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRR 71
            |:|...||||:||...::|..||:|||||.|:..||.       :.|||                
pombe     4 DSLKDAIAGGAAGLASSLVVAPLDVVKTRKQAQKAFY-------STGGG---------------- 45

  Fly    72 KLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLV 136
                      ....|:||.          :||           :|.|..|||...|::|:||.::
pombe    46 ----------KNTMVLGGT----------LSS-----------MRTIFHNEGIAGLYRGVGPMML 79

  Fly   137 GVAPSRAIYFCTYSQTK------NTLNSLGFVERDSPLV-------------------HIMSAAS 176
            |..||.:|||..|.:.|      ....||.  |.||..|                   .|.||..
pombe    80 GYLPSWSIYFVVYEKCKVLFGVNKKYTSLH--EIDSSKVGIKASLDSSDKQFYRYWGGQIFSAVI 142

  Fly   177 AGFVSSTATNPIWFVKTR--------------------------MQLDYNS----------KVQM 205
            ||..|.|.|||||.||||                          :|.|..|          |.:.
pombe   143 AGAASVTLTNPIWVVKTRLVTQSHPRASSFVDKIAAATTVQFRNLQTDAPSVKWRMPRFWLKRRT 207

  Fly   206 TVR------------------------QCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEF 246
            .|:                        ....::|...|:||||:|:..|.||.....:.|.:||:
pombe   208 NVKSSPSQHPVNPPTGPACSPAYNNTFDAFRKIYKYEGLAAFYRGLFPSLFGTLHVGIQFPLYEY 272

  Fly   247 IKSKLLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLRE-EGNKYNSFWQTL 310
            .||.|        .|..|.:.....::|..:||..||.:.|||||.||||:. :...:||....:
pombe   273 FKSFL--------DDFFGKKSNFHIVLAATLSKIAASTVTYPHEVLRTRLQSLDAPTHNSATLLI 329

  Fly   311 HTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAV 347
            ..:|:.||....|.|:||..:|.||.:::...::|.|
pombe   330 RDIWRSEGWRKYYSGMATNFIRTIPASSVTFLSFEIV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 43/153 (28%)
Mito_carr 163..253 CDD:278578 41/168 (24%)
Mito_carr 268..355 CDD:278578 28/81 (35%)
SPAC227.03cNP_592957.1 Mito_carr <22..100 CDD:278578 36/131 (27%)
Mito_carr 132..277 CDD:278578 36/144 (25%)
Mito_carr 282..370 CDD:278578 29/85 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I2584
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.