DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and Allc

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001013055.1 Gene:Allc / 246758 RGDID:621804 Length:413 Species:Rattus norvegicus


Alignment Length:153 Identity:35/153 - (22%)
Similarity:58/153 - (37%) Gaps:27/153 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AQNTADTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQS-STAFMTPSRLAENAGGGPANGGQSELL 65
            |..:.||:.::...|.  .:||..|....|..|.|:| |..::.|  ::|...|.|.:......:
  Rat   114 ANLSEDTVTNIPPRGV--KMGAAATSEEFVAITELKSHSWDYLVP--MSELKPGDPDSSHNYFFV 174

  Fly    66 RPEQRRKLSTTILRNRSQPQVIGGVRRIMAI-----SHCGISSTTPKSMSIVQ----CLRHIVQN 121
            ..:||    .|.:|....|.  |||.|:...     ....:.||.|..:..:.    |:      
  Rat   175 NSQQR----WTHIRLNIFPD--GGVARLRVYGTGQRDWAALDSTEPVDLVAIAFGGVCV------ 227

  Fly   122 EGPRALFKGLGPNLVGVAPSRAI 144
             |......|...|::||...::|
  Rat   228 -GFSNAHFGHPNNMIGVGDPKSI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 33/147 (22%)
Mito_carr 163..253 CDD:278578
Mito_carr 268..355 CDD:278578
AllcNP_001013055.1 allantoicase 18..385 CDD:274363 35/153 (23%)
Allantoicase 28..200 CDD:281549 25/95 (26%)
Allantoicase 223..384 CDD:281549 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.