DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim2 and slc25a17

DIOPT Version :9

Sequence 1:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001092731.2 Gene:slc25a17 / 100093708 ZFINID:ZDB-GENE-070620-4 Length:317 Species:Danio rerio


Alignment Length:361 Identity:79/361 - (21%)
Similarity:140/361 - (38%) Gaps:95/361 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRR 71
            ::|:|.:||.........|..||:..:.|||                             .:::|
Zfish    15 ESLVHAVAGAMGSVTAMTVFFPLDTARLRLQ-----------------------------VDEKR 50

  Fly    72 KLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLV 136
            |..:|       |.:                            |..|::.||..|.::|..|.:.
Zfish    51 KAKST-------PAI----------------------------LSEIIKEEGLLAPYRGWFPVIC 80

  Fly   137 GVAPSRAIYF-CTYSQTKNTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQLD-- 198
            .:..|..:|| |.:|.....|..    :|.:....::...:||.|:...|.|:|.|.||::|.  
Zfish    81 SLCCSNFVYFYCFHSLKATWLQG----QRSTAGRDLIIGIAAGVVNVLVTTPLWVVNTRLKLQGA 141

  Fly   199 --YNSKVQMT----VRQCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRNQ 257
              .|..:|.|    ::....::..|.||.|.:.|...|...:....|.|:|||.:|.::|...::
Zfish   142 KFRNEDIQPTHYNGIKDAFVQIMRQEGVGALWNGTFPSLLLVLNPAVQFMIYEGLKRQILRGVHR 206

  Fly   258 RHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLR--EEG---------NKYNSFWQTLH 311
            ..:.       :|..:.|||:|.:|:.|.||.:..::.||  :.|         |...|....|.
Zfish   207 ELSS-------VEVFLIGAVAKAVATTITYPLQTVQSVLRFGQHGQPAGQSRLLNSLRSVMYLLI 264

  Fly   312 TVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAV 347
            ...::.|..||::||..:|::.:...|:|...||.:
Zfish   265 NRVRKWGILGLFKGLEAKLLQTVLTAALMFLLYEKI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 26/148 (18%)
Mito_carr 163..253 CDD:278578 26/97 (27%)
Mito_carr 268..355 CDD:278578 25/91 (27%)
slc25a17NP_001092731.2 Mito_carr 17..101 CDD:278578 26/147 (18%)
Mito_carr 104..202 CDD:278578 26/97 (27%)
Mito_carr 207..300 CDD:278578 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.