DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frtz and frtz

DIOPT Version :10

Sequence 1:NP_608614.1 Gene:frtz / 33349 FlyBaseID:FBgn0086698 Length:951 Species:Drosophila melanogaster
Sequence 2:XP_061506941.1 Gene:frtz / 1269309 VectorBaseID:AGAMI1_003105 Length:1304 Species:Anopheles gambiae


Alignment Length:66 Identity:17/66 - (25%)
Similarity:29/66 - (43%) Gaps:20/66 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 QIVYREMKRHGNMPLGCPIAVD-VYKFRNVTTGQMRLPAFFGRADFML-DVNG-LLGSANIRTFD 174
            |..|.::|:.          || |::|:.||.|...:       |.:: |.|| :|.....:.:|
Mosquito    30 QCFYEDLKKD----------VDTVFEFQVVTGGHYDV-------DLIIEDPNGKVLYKDTKKQYD 77

  Fly   175 S 175
            |
Mosquito    78 S 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frtzNP_608614.1 Frtz 47..597 CDD:432059 17/66 (26%)
Atrophin-1 <654..>879 CDD:460830
frtzXP_061506941.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.