DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL48 and RSM10

DIOPT Version :9

Sequence 1:NP_001259878.1 Gene:mRpL48 / 33348 FlyBaseID:FBgn0031357 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_010326.1 Gene:RSM10 / 851611 SGDID:S000002448 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:34/142 - (23%)
Similarity:60/142 - (42%) Gaps:25/142 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ATTTAVRSTSGSVY----EPDYLESLKPKFP-QYESL--NVQIKGYDYPQLESYQRFLHGLAEYL 75
            |..:.:|:.|...|    |..|...|  |.| :|..|  ::|::.||...|:.|..|:.....||
Yeast     7 ALRSFIRTQSTRPYPVNVEAVYYAPL--KLPIKYGDLVADIQLRSYDNENLDFYSDFILRTGYYL 69

  Fly    76 DLDVSDCYALPPQKTTVQRLRPNSTVIESEY----KLTTYERNLQLNNVDA-PVYPQFLRLAQAA 135
            .:.::....||.:       |...|||:|.:    ....:||:.....:.| ...|:.|::..|.
Yeast    70 GIPLTGPKPLPTR-------RERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEVLQMLIAY 127

  Fly   136 LPE----GVSLQ 143
            :.:    ||.::
Yeast   128 ITKHSMAGVGMK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL48NP_001259878.1 Ribosomal_S10 50..144 CDD:278753 23/103 (22%)
RSM10NP_010326.1 Ribosomal_S10 45..141 CDD:395267 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.