DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL48 and mrpl-48

DIOPT Version :9

Sequence 1:NP_001259878.1 Gene:mRpL48 / 33348 FlyBaseID:FBgn0031357 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_504475.1 Gene:mrpl-48 / 259341 WormBaseID:WBGene00016989 Length:186 Species:Caenorhabditis elegans


Alignment Length:163 Identity:57/163 - (34%)
Similarity:97/163 - (59%) Gaps:7/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AVRSTSGS-----VYEPDYLESLKPKFPQYESLNVQIKGYDYPQLESYQRFLHGLAEYLDLDVSD 81
            ::|.|.|.     :|||.:.:|  .:||:|.::||:|:|:|:..||.||.::|..|:.....|.|
 Worm    21 SLRETVGERDASLLYEPKFQDS--REFPEYNTINVRIQGHDFGSLEKYQAYIHKTAKRFGFTVVD 83

  Fly    82 CYALPPQKTTVQRLRPNSTVIESEYKLTTYERNLQLNNVDAPVYPQFLRLAQAALPEGVSLQVQE 146
            .||:..|.......:|.|||.|||..::||:|.::|::|.||.:..|.::.:|.:|.||::.|:|
 Worm    84 SYAVAAQTQKAITYKPYSTVSESEIDMSTYDRVVRLSDVAAPRFSLFSQIIRAHIPIGVTMTVKE 148

  Fly   147 YTDDCEERRYVPDKELLDLKDELERMGGPTTTR 179
            :....|:.||:||..|...::||:.:..|...|
 Worm   149 HEKVDEDSRYIPDLLLKQKQEELKALDDPNVRR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL48NP_001259878.1 Ribosomal_S10 50..144 CDD:278753 35/93 (38%)
mrpl-48NP_504475.1 Ribosomal_S10 52..147 CDD:366038 35/94 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166865
Domainoid 1 1.000 69 1.000 Domainoid score I6338
eggNOG 1 0.900 - - E1_KOG4060
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H33884
Inparanoid 1 1.050 106 1.000 Inparanoid score I3514
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29065
OrthoDB 1 1.010 - - D1522619at2759
OrthoFinder 1 1.000 - - FOG0007045
OrthoInspector 1 1.000 - - oto19191
orthoMCL 1 0.900 - - OOG6_108750
Panther 1 1.100 - - LDO PTHR13473
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3521
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.