DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL48 and rsm10

DIOPT Version :9

Sequence 1:NP_001259878.1 Gene:mRpL48 / 33348 FlyBaseID:FBgn0031357 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_596611.3 Gene:rsm10 / 2540539 PomBaseID:SPBC211.01 Length:228 Species:Schizosaccharomyces pombe


Alignment Length:201 Identity:40/201 - (19%)
Similarity:77/201 - (38%) Gaps:36/201 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRRILP----SVRLALQVPKATTTAVRSTSGSVYEPDYLESLKP----------KFPQYES---- 48
            |.|:.|    ...:..:.||.     .|....::|..:.:.|..          ||...|:    
pombe     9 LPRVQPKRCFQTAIGKESPKG-----NSEKDQLFENPFFQQLPSNVAAVYLNPVKFNPSENDVLC 68

  Fly    49 LNVQIKGYDYPQLESYQRFLHGLAEYLDLDVSDCYALPPQKTTVQRLRPNSTVI----ESEYKLT 109
            .:::||.::.|:|:::..|:...|.|:.:.:.....||.:..:...||  |..|    :..::..
pombe    69 ASLKIKSFETPKLDTFTDFICRTAYYMKIPIKGPRPLPNKVESWTLLR--SPFIHKSSQENFERI 131

  Fly   110 TYERNLQLNNVDAPVYPQFLRLAQAALPEGVSLQVQEY----TDDCEERRYVPDKELLDLKDELE 170
            |:.|.:||.:|:......|....:......:.||.:.|    .||..:......|...:.|   |
pombe   132 THSRLIQLYSVNPVTLETFFSYLRKCNMWDLKLQAKAYEYESIDDALKNFESQSKSTDNFK---E 193

  Fly   171 RMGGPT 176
            .:.||:
pombe   194 LLNGPS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL48NP_001259878.1 Ribosomal_S10 50..144 CDD:278753 20/97 (21%)
rsm10NP_596611.3 rpsJ_bact 71..166 CDD:130121 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.