DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17660 and AT1G72480

DIOPT Version :9

Sequence 1:NP_608612.3 Gene:CG17660 / 33347 FlyBaseID:FBgn0031356 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_177392.1 Gene:AT1G72480 / 843580 AraportID:AT1G72480 Length:509 Species:Arabidopsis thaliana


Alignment Length:280 Identity:88/280 - (31%)
Similarity:147/280 - (52%) Gaps:5/280 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PHGFISAIDWPFLPFYLIMCIVYVIFGIIWLFVSFAQWRDLLRIQFWIGGVILLGMLEKAFFYAE 254
            |.|::.....|.:.||..|.:.:|:.||.|.......||::|.:|..:..||.|||.|.|.:|.:
plant   192 PTGYLPGRMAPLMYFYGFMSLAFVLLGIFWFSQCARFWREVLPLQNCLTLVITLGMCEMALWYFD 256

  Fly   255 YQTLTNKGVAVQHAELVAEFVSCAKRTLARMLVIIMSLGFGIVKPRLGPMLHRVVGVGTLYFVLA 319
            |......|:......:.|......|||.||::::::|:|:|:|:|.||....:|:.:|..:|:.:
plant   257 YAEFNETGIRPTVITIWAVTFGSIKRTSARIIILMVSMGYGVVRPTLGGFTSKVIMLGVTFFIAS 321

  Fly   320 CVESYLRITNVKTDRS--ELLVASIPLAVLDTGICWWIFTSLVQTTRTLRLRRNMVKLSLYRHFT 382
            .:...:......:|.|  ..|...:|:|:||.....|||.||..|.:.|:.||.:|||.:||.||
plant   322 EILELMENVGAVSDLSGKARLFFVLPVAILDAFFIIWIFKSLSATFKKLQTRRLLVKLDIYRKFT 386

  Fly   383 NTLIFAVIASVIFMLFALRLRRVENCTPGWRDIWVDTGFWHILFSVLLLVIMILWRPTNNNQRYA 447
            |.|...::.|:.::.:.|..:..:.....|::.|:...||.:|...||:||..||.|:.|:.|||
plant   387 NALAVDILVSLGWICYELYFKSKDVYNEHWQNAWIIPAFWQLLSFSLLIVICSLWAPSQNSTRYA 451

  Fly   448 FTPLLDNPEDEDDEDEEDQF 467
            |:   .:..|...|.|:|.:
plant   452 FS---GSSGDTSAEFEKDDY 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17660NP_608612.3 Lung_7-TM_R 160..444 CDD:284280 80/255 (31%)
AT1G72480NP_177392.1 Lung_7-TM_R 162..448 CDD:284280 80/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 174 1.000 Domainoid score I1109
eggNOG 1 0.900 - - E1_KOG2568
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I1448
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1448608at2759
OrthoFinder 1 1.000 - - FOG0001340
OrthoInspector 1 1.000 - - otm2733
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21229
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1432
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.