DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chinmo and zbtb24

DIOPT Version :9

Sequence 1:NP_001188680.1 Gene:chinmo / 33343 FlyBaseID:FBgn0086758 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001018866.2 Gene:zbtb24 / 553955 ZFINID:ZDB-GENE-081022-123 Length:678 Species:Danio rerio


Alignment Length:141 Identity:42/141 - (29%)
Similarity:65/141 - (46%) Gaps:14/141 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FSNLFKSDLLADVILSCDGVVFKAHKLILAACSKKFADLFENTPTNGQCVIILEATTPDNMAALL 86
            |..|.:|:||.|:.|..:.|.|||||.:|||.|:.|:.||.......|.:..|:..|.:..:::|
Zfish    32 FDTLRRSELLCDITLIVEDVHFKAHKALLAASSEYFSALFTAEEQVSQSLYKLDGMTANTFSSVL 96

  Fly    87 EFMYKGEVHVSQEALNSFLKSAESLQVKGLSTETGRLAAQQAQQHM------------GDLSPLD 139
            ||||...|.|.:.:....::.|..|.:..|......|  |...:||            .|||..:
Zfish    97 EFMYSAVVLVDESSSEQLMEMARFLVIPDLIKAHEDL--QAVDEHMQVKRKRGRPKKNQDLSQKE 159

  Fly   140 SPTGRRSVRNS 150
            :|......::|
Zfish   160 NPESELQAQSS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chinmoNP_001188680.1 BTB 22..116 CDD:279045 32/93 (34%)
BTB 33..116 CDD:197585 27/82 (33%)
C2H2 Zn finger 519..540 CDD:275368
C2H2 Zn finger 547..568 CDD:275368
zbtb24NP_001018866.2 BTB 32..129 CDD:279045 33/96 (34%)
BTB 43..129 CDD:197585 28/85 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..211 7/32 (22%)
C2H2 Zn finger 242..262 CDD:275368
zf-H2C2_2 255..279 CDD:290200
COG5048 <266..456 CDD:227381
C2H2 Zn finger 270..290 CDD:275368
zf-H2C2_2 283..307 CDD:290200
C2H2 Zn finger 298..318 CDD:275368
zf-H2C2_2 310..335 CDD:290200
zf-C2H2 324..346 CDD:278523
C2H2 Zn finger 326..346 CDD:275368
C2H2 Zn finger 354..374 CDD:275368
zf-H2C2_2 367..390 CDD:290200
C2H2 Zn finger 382..402 CDD:275368
zf-H2C2_2 395..418 CDD:290200
C2H2 Zn finger 410..430 CDD:275368
zf-C2H2 436..458 CDD:278523
C2H2 Zn finger 438..458 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.