DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chinmo and rib

DIOPT Version :9

Sequence 1:NP_001188680.1 Gene:chinmo / 33343 FlyBaseID:FBgn0086758 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001261085.1 Gene:rib / 44855 FlyBaseID:FBgn0003254 Length:680 Species:Drosophila melanogaster


Alignment Length:638 Identity:136/638 - (21%)
Similarity:206/638 - (32%) Gaps:227/638 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QQFCLKWNSFSSNLAITFSNLFKSDLLADVILSCDGVVFKAHKLILAACSKKFADLFENTPTNGQ 69
            |.:||:||:..:||......|.:.....|..|..|...|:||:::|||.|..|..:.::.|.: .
  Fly    16 QTYCLRWNNHQTNLVQILHALHEVGSYVDCSLVVDDEQFQAHRVVLAANSPYFQHILKDVPQD-H 79

  Fly    70 CVIILEATTPDNMAALLEFMYKGEVHVSQEALNSFLKSAESLQVKGL-----------STETGRL 123
            |.|||.......:||||::||.||..|::......|::|:.||||||           .|.|...
  Fly    80 CSIILPGVKGFEIAALLQYMYTGETTVTKSQEPEILRTAKELQVKGLYDNLMKFNHASVTPTSSS 144

  Fly   124 AAQQAQQHMGDLSPLDSPTGRRSVRNSLSGG----------------------------SSSIVP 160
            .|..|:...|..|...|.....|...|.|..                            |:|.:|
  Fly   145 GAGGAKPQNGSASNHSSSVISTSTHISPSAAISSSCSPPPPPQFGYQPGYSHYPQQQPMSASQIP 209

  Fly   161 GGVGIGLGGGATGANSMSGMGIGNGLSLAGMAAGGGMAAAANAAASSLSTL---AASANIVDR-- 220
            .|........||..::.||.|          .|||......:|||:.|:::   ||..|.:.|  
  Fly   210 AGEAPLTPTQATPHSAASGAG----------EAGGQWPLTPSAAAAMLNSVYESAADMNPLKRKK 264

  Fly   221 CGSAGANIISG-----------SAAGIGGSHSGGAGNGSG----------TVGIGGNGVGSG--- 261
            ..:..:.::||           :.|....|...|..|.:|          |....|.||..|   
  Fly   265 LSAISSMLLSGNRDTPILRNVLAQANPADSSQPGPMNANGEKTPTHPHQNTQLPAGLGVSGGERN 329

  Fly   262 --------GGNNGPISLGSGAGAAHHLGGSTG---------------------ILKQECDSLM-- 295
                    ||:..|:|..:........|.|.|                     .:::...:|.  
  Fly   330 HSFNGSDYGGDKEPLSPYTDRSFEEETGQSGGKKPEWKRYKQYTRADMMCAIQAVREGMSALQAS 394

  Fly   296 -------------------------------HPGGSSSSSGMGYT-------------------- 309
                                           .|.|:.||.|..|:                    
  Fly   395 RKYGLPSRTLYDKVRKLNITTGRGTHRTPKRSPPGAESSQGFSYSAAAAAAAHNYGHGHGHHSEV 459

  Fly   310 -------HVPPIYRPINYEPPRKRAIVRSPYSEQ--EQRGSVLRDGSKSSECPSPINKPPYHRPS 365
                   |||..:......||...|::...:.:|  |.||..:            ..:...|..:
  Fly   460 KRDQKVDHVPAHHGMPPTIPPSAAALLDHAFLQQALENRGGDM------------AGREALHAMA 512

  Fly   366 SSAS--------STAPTEADTM---HSERA-SPQSSRY-----------ENHSPSTTAGNGNATS 407
            .:|:        |::|.|.|..   |..|: |||...|           |.|.            
  Fly   513 LAAAAHAAANRLSSSPAEMDQRSNGHGMRSPSPQGRHYPHEQEAMDLEMEKHE------------ 565

  Fly   408 SLERIVKSERNNGSANEANDDDRELMDESTDNGAEDL---RVKLENLKYSPPP 457
              :.|:|.||:.....:|:|::    |...:: .|||   |.:.....|||.|
  Fly   566 --QNIIKRERDQDEREDADDEE----DHEQEH-VEDLSLARKERPPSPYSPQP 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chinmoNP_001188680.1 BTB 22..116 CDD:279045 32/93 (34%)
BTB 33..116 CDD:197585 31/82 (38%)
C2H2 Zn finger 519..540 CDD:275368
C2H2 Zn finger 547..568 CDD:275368
ribNP_001261085.1 BTB 33..133 CDD:279045 34/100 (34%)
BTB 44..133 CDD:197585 33/89 (37%)
HTH_psq 373..417 CDD:283007 1/43 (2%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10373
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.