DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chinmo and lolal

DIOPT Version :9

Sequence 1:NP_001188680.1 Gene:chinmo / 33343 FlyBaseID:FBgn0086758 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster


Alignment Length:117 Identity:55/117 - (47%)
Similarity:77/117 - (65%) Gaps:1/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDPQQQFCLKWNSFSSNLAITFSNLFKSDLLADVILSCDGVVFKAHKLILAACSKKFADLFENTP 65
            |...|||.||||.|.:|:..:|.:|.......||.|:|:|...||||::|:|||..|..|.|..|
  Fly     2 MSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENP 66

  Fly    66 TNGQCVIILEATTPDNMAALLEFMYKGEVHVSQEALNSFLKSAESLQVKGLS 117
            :. ..:|||:..:..::.|:|||||.|||:||||.|.:|||:|:.|:||||:
  Fly    67 SK-HPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLA 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chinmoNP_001188680.1 BTB 22..116 CDD:279045 43/93 (46%)
BTB 33..116 CDD:197585 41/82 (50%)
C2H2 Zn finger 519..540 CDD:275368
C2H2 Zn finger 547..568 CDD:275368
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 40/83 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9675
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.