DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chinmo and ab

DIOPT Version :10

Sequence 1:NP_722717.2 Gene:chinmo / 33343 FlyBaseID:FBgn0086758 Length:840 Species:Drosophila melanogaster
Sequence 2:XP_061509624.1 Gene:ab / 3291640 VectorBaseID:AGAMI1_014384 Length:1034 Species:Anopheles gambiae


Alignment Length:64 Identity:15/64 - (23%)
Similarity:26/64 - (40%) Gaps:22/64 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFSLACLIISTSSRNTHK--------------------VIPIVTSVELRDNLKYLNSSATIHNA 54
            ::.|.|:..:|.|.:..|                    |:|::.|: ..||..|.|.:|. :||
Mosquito   227 IYHLTCVGSATVSESAKKLQRMFLKIVSVQISIPLIAIVLPVLYSM-YADNTSYYNQAAN-NNA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chinmoNP_722717.2 BTB_POZ_BAB-like 31..115 CDD:349624 9/24 (38%)
C2H2 Zn finger 519..540 CDD:275368
C2H2 Zn finger 547..568 CDD:275368
abXP_061509624.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.