DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14352 and Msantd3

DIOPT Version :9

Sequence 1:NP_608609.1 Gene:CG14352 / 33341 FlyBaseID:FBgn0031351 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001102134.1 Gene:Msantd3 / 362516 RGDID:1308165 Length:275 Species:Rattus norvegicus


Alignment Length:248 Identity:47/248 - (18%)
Similarity:98/248 - (39%) Gaps:42/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AKNFTIEEEEILENLILAHRDVIRNKQKDPAIWRKKSEAWKQIEADFAIQTGIE-RSWQALREKY 74
            ||.|:..|:.||..|:..::.|:..|:.|......|...|:.:..::..|..:. |.::.|: |.
  Rat    10 AKYFSELEKSILLALVEKYKYVLECKKSDARTIALKQRTWQALAHEYNSQPSVSLRDFKQLK-KC 73

  Fly    75 TNNLRMMRKNGTLSDEEAKTDNASDSVQNLSISGVSSLAA---------AADNEESSTYFESELN 130
            ..|::...|.....:...|...:...:.:..:.....:.:         .:..||...|.:....
  Rat    74 WENIKARTKKIMAHERREKVKRSGSPLLSTHVLDKEKIGSMLPEQLYFLQSPPEEEPEYHQDAAA 138

  Fly   131 RKSLRSASTEV-----KLV--PNNSSYSVDRPNYSALNV--NEESVDVSSEEDATNTLKDE---- 182
            ::|...::.|:     :.|  |.....|...|:.||:.:  |:.....:.:|.|...:.:|    
  Rat   139 QESFAVSNRELCDDEKEFVHFPVCEGTSQPEPSCSAVRITANKNYRSKTPQEGALKKMHEEEHHQ 203

  Fly   183 -------------KVVLIRLQQEYYRCENARAAEKHKLEME---KQKYELEQR 219
                         :|.:.::||....||  .|.|:|:::||   |:|...|::
  Rat   204 QMSILQLQLIQMNEVHVAKIQQIERECE--MAEEEHRIKMEVLNKKKMYWERK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14352NP_608609.1 Myb_DNA-bind_5 10..84 CDD:290584 17/73 (23%)
Msantd3NP_001102134.1 Myb_DNA-bind_5 10..87 CDD:404714 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_298CU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.