DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment haf and LRRC59

DIOPT Version :9

Sequence 1:	NP_001356954.1	Gene:	haf / 33339	FlyBaseID:	FBgn0261509	Length:	1347	Species:	Drosophila melanogaster
Sequence 2:	NP_060979.2	Gene:	LRRC59 / 55379	HGNCID:	28817	Length:	307	Species:	Homo sapiens

Alignment Length:	111	Identity:	42/111 - (37%)
Similarity:	58/111 - (52%)	Gaps:	13/111 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   135 NLQDNL-----------LADVPVEALKVLGKLNLLDLSKNQLSHIPDDAFVGLTKLSTLKLNDNN 188
            ||:|.|           |.:|||:.|..|.|..:||||.|:|:.:|.| |.|||.|..|.|:.|.
Human    10 NLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKLTTLPSD-FCGLTHLVKLDLSKNK 73

  Fly   189 VTLASNAFRGLEQSLKNLNLKGTKQRKVPESIRGLKSLAFLDLSQN 234
            :......| |...:|::|:|...|...:|.|...||:|.:|||..|
Human    74 LQQLPADF-GRLVNLQHLDLLNNKLVTLPVSFAQLKNLKWLDLKDN 118

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
haf	NP_001356954.1	LRR	<52..>252	CDD:227223	42/111 (38%)
		leucine-rich repeat	86..105	CDD:275380
		leucine-rich repeat	106..129	CDD:275380
		LRR_8	131..189	CDD:338972	27/64 (42%)
		leucine-rich repeat	131..154	CDD:275380	10/29 (34%)
		leucine-rich repeat	155..178	CDD:275380	11/22 (50%)
		leucine-rich repeat	179..202	CDD:275380	6/22 (27%)
		leucine-rich repeat	203..225	CDD:275380	7/21 (33%)
		leucine-rich repeat	226..253	CDD:275380	5/9 (56%)
		LRR_8	254..337	CDD:338972
		leucine-rich repeat	254..302	CDD:275380
		leucine-rich repeat	303..326	CDD:275380
		leucine-rich repeat	327..350	CDD:275380
		PCC	332..>413	CDD:188093
		PRK10927	<1061..>1097	CDD:236797
LRRC59	NP_060979.2	LRR 1	10..31		5/20 (25%)
		LRR	<18..>120	CDD:227223	38/103 (37%)
		leucine-rich repeat	19..40	CDD:275378	6/20 (30%)
		LRR 2	40..62		11/22 (50%)
		leucine-rich repeat	41..63	CDD:275378	11/22 (50%)
		LRR 3	63..84		6/21 (29%)
		leucine-rich repeat	64..86	CDD:275378	6/22 (27%)
		LRR 4	86..107		6/20 (30%)
		leucine-rich repeat	87..109	CDD:275378	7/21 (33%)
		LRR 5	109..128		5/10 (50%)
		InfB	135..>243	CDD:392272
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	150..241
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910