DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment haf and TLR8

DIOPT Version :9

Sequence 1:NP_001356954.1 Gene:haf / 33339 FlyBaseID:FBgn0261509 Length:1347 Species:Drosophila melanogaster
Sequence 2:NP_057694.2 Gene:TLR8 / 51311 HGNCID:15632 Length:1059 Species:Homo sapiens


Alignment Length:417 Identity:92/417 - (22%)
Similarity:149/417 - (35%) Gaps:122/417 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PDLQTSCICAYNLGRELSVQCDQVDFSQLLAAMNTHARLKPVDLLYVNNSTISELPDAVFSNLSL 106
            |.::..| .||....:||:.                      .:.::..:....|||....|||.
Human   491 PLIKPQC-AAYGKALDLSLN----------------------SIFFIGPNQFENLPDIACLNLSA 532

  Fly   107 H-NLQLSSCGIQRIATGAFKGQE----SVLRNLNLQDNLLADVPVEALKVLGKLNLLDLSKNQLS 166
            : |.|:.|            |.|    ..::.|:|.:|.|......||..|..|.:||||.|  |
Human   533 NSNAQVLS------------GTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLDLSYN--S 583

  Fly   167 HIPDDAFV--------GLTKLSTLKLNDNNVTLASNAFRGLEQSLKNLNLKGTK--------QRK 215
            |....|.|        ..|.|..|.|:.||:...::.:....:||..|...|.:        ..:
Human   584 HYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNR 648

  Fly   216 VPESIRGLKSLAFLDLSQNGIKELPGAGGIRVFDGLDA-LTALNLERNLIQSIGET--------- 270
            .....:|||:|..||||.|.:|.:|.    ..|..|.| ||.|::..|:::....|         
Human   649 YISIFKGLKNLTRLDLSLNRLKHIPN----EAFLNLPASLTELHINDNMLKFFNWTLLQQFPRLE 709

  Fly   271 --------------AFAGVRKTLSSLSLLNNLLAEFPIGAVHSLKELRVLDIGFNLLTSLPEAAF 321
                          :.:....:|.:|.|.:|.::..|.|.:..:..|:.||:..|||.::.::|.
Human   710 LLDLRGNKLLFLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSAL 774

  Fly   322 --RGNPGITLLALDGNPLSSVPEGAFAHLNATLRGLSLGGRFLHCDCKL----RWVAEWIRNGDL 380
              :....:::|.|.|||                         ..|.|.:    ||:.|     .|
Human   775 ETKTTTKLSMLELHGNP-------------------------FECTCDIGDFRRWMDE-----HL 809

  Fly   381 QVTSRERNPQFCGTPPRFRDRGFYSIQ 407
            .|.........|.:|...|.:...|::
Human   810 NVKIPRLVDVICASPGDQRGKSIVSLE 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hafNP_001356954.1 LRR <52..>252 CDD:227223 53/220 (24%)
leucine-rich repeat 86..105 CDD:275380 4/18 (22%)
leucine-rich repeat 106..129 CDD:275380 5/27 (19%)
LRR_8 131..189 CDD:338972 22/65 (34%)
leucine-rich repeat 131..154 CDD:275380 7/22 (32%)
leucine-rich repeat 155..178 CDD:275380 10/30 (33%)
leucine-rich repeat 179..202 CDD:275380 5/22 (23%)
leucine-rich repeat 203..225 CDD:275380 5/29 (17%)
leucine-rich repeat 226..253 CDD:275380 10/26 (38%)
LRR_8 254..337 CDD:338972 22/107 (21%)
leucine-rich repeat 254..302 CDD:275380 11/70 (16%)
leucine-rich repeat 303..326 CDD:275380 7/24 (29%)
leucine-rich repeat 327..350 CDD:275380 5/22 (23%)
PCC 332..>413 CDD:188093 15/80 (19%)
PRK10927 <1061..>1097 CDD:236797
TLR8NP_057694.2 LRR_8 83..155 CDD:290566
leucine-rich repeat 83..106 CDD:275380
leucine-rich repeat 107..144 CDD:275380
leucine-rich repeat 145..165 CDD:275380
leucine-rich repeat 166..189 CDD:275380
leucine-rich repeat 190..220 CDD:275380
leucine-rich repeat 221..241 CDD:275380
LRR_8 240..317 CDD:290566
leucine-rich repeat 242..265 CDD:275380
leucine-rich repeat 266..306 CDD:275380
LRR_8 305..367 CDD:290566
leucine-rich repeat 307..330 CDD:275380
leucine-rich repeat 331..356 CDD:275380
leucine-rich repeat 387..413 CDD:275380
LRR_8 412..>449 CDD:290566
leucine-rich repeat 414..437 CDD:275380
LRR_8 502..560 CDD:290566 16/91 (18%)
LRR_RI <504..719 CDD:238064 59/254 (23%)
leucine-rich repeat 504..524 CDD:275380 3/41 (7%)
leucine-rich repeat 525..549 CDD:275380 8/35 (23%)
LRR_8 548..614 CDD:290566 22/67 (33%)
leucine-rich repeat 550..573 CDD:275380 7/22 (32%)
leucine-rich repeat 574..603 CDD:275380 10/30 (33%)
leucine-rich repeat 604..658 CDD:275380 11/53 (21%)
LRR_8 657..718 CDD:290566 17/64 (27%)
leucine-rich repeat 659..683 CDD:275380 10/27 (37%)
leucine-rich repeat 684..707 CDD:275380 5/22 (23%)
LRR_8 706..766 CDD:290566 10/59 (17%)
leucine-rich repeat 708..730 CDD:275380 0/21 (0%)
leucine-rich repeat 732..755 CDD:275380 6/22 (27%)
leucine-rich repeat 756..775 CDD:275380 7/18 (39%)
LRRCT 790..835 CDD:214507 12/74 (16%)
TIR 898..1040 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.