| Sequence 1: | NP_001356954.1 | Gene: | haf / 33339 | FlyBaseID: | FBgn0261509 | Length: | 1347 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001011310.1 | Gene: | lrrc40 / 496765 | XenbaseID: | XB-GENE-968689 | Length: | 605 | Species: | Xenopus tropicalis |
| Alignment Length: | 305 | Identity: | 89/305 - (29%) |
|---|---|---|---|
| Similarity: | 127/305 - (41%) | Gaps: | 61/305 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 63 DQVDFSQLLAAMNTHARLKPVDLLYVNNSTISELPDAVFSNLSLHNLQLSS--CGIQRIATGAFK 125
Fly 126 GQESVLRNLNLQDNLLADVPVEALKVLGKLNLLDLSKNQLSHIPD-------------------- 170
Fly 171 -DAFVG-LTKLSTLKLNDNNVTLASNAFRGLEQSLKNLNLKGTKQRKVPESIRGLKSLAFLDLSQ 233
Fly 234 NGIKELPGAGGIRVFDGLDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLN---NLLAEFPIG 295
Fly 296 AVHSLKELRVLDIGFNLLTSLPEAAFRGNPGITLLALDGNPLSSV 340 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| haf | NP_001356954.1 | LRR | <52..>252 | CDD:227223 | 57/212 (27%) |
| leucine-rich repeat | 86..105 | CDD:275380 | 6/18 (33%) | ||
| leucine-rich repeat | 106..129 | CDD:275380 | 5/24 (21%) | ||
| LRR_8 | 131..189 | CDD:338972 | 23/79 (29%) | ||
| leucine-rich repeat | 131..154 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 155..178 | CDD:275380 | 11/44 (25%) | ||
| leucine-rich repeat | 179..202 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 203..225 | CDD:275380 | 7/21 (33%) | ||
| leucine-rich repeat | 226..253 | CDD:275380 | 8/26 (31%) | ||
| LRR_8 | 254..337 | CDD:338972 | 29/85 (34%) | ||
| leucine-rich repeat | 254..302 | CDD:275380 | 16/50 (32%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 6/14 (43%) | ||
| PCC | 332..>413 | CDD:188093 | 5/9 (56%) | ||
| PRK10927 | <1061..>1097 | CDD:236797 | |||
| lrrc40 | NP_001011310.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..26 | ||
| LRR | <82..348 | CDD:227223 | 87/299 (29%) | ||
| LRR 1 | 83..104 | 7/29 (24%) | |||
| leucine-rich repeat | 84..106 | CDD:275380 | 7/30 (23%) | ||
| LRR 2 | 106..127 | 7/22 (32%) | |||
| leucine-rich repeat | 107..129 | CDD:275380 | 7/23 (30%) | ||
| LRR 3 | 129..151 | 7/31 (23%) | |||
| leucine-rich repeat | 130..152 | CDD:275380 | 8/22 (36%) | ||
| LRR 4 | 152..173 | 8/20 (40%) | |||
| leucine-rich repeat | 153..175 | CDD:275380 | 8/21 (38%) | ||
| LRR 5 | 175..196 | 2/20 (10%) | |||
| leucine-rich repeat | 176..198 | CDD:275380 | 3/21 (14%) | ||
| LRR 6 | 198..219 | 5/21 (24%) | |||
| leucine-rich repeat | 199..221 | CDD:275380 | 5/22 (23%) | ||
| LRR 7 | 221..242 | 6/20 (30%) | |||
| leucine-rich repeat | 222..244 | CDD:275380 | 7/21 (33%) | ||
| internalin_A | 238..>583 | CDD:380193 | 42/125 (34%) | ||
| LRR 8 | 244..265 | 8/26 (31%) | |||
| leucine-rich repeat | 245..266 | CDD:275380 | 8/26 (31%) | ||
| LRR 9 | 266..287 | 6/24 (25%) | |||
| leucine-rich repeat | 267..290 | CDD:275380 | 7/26 (27%) | ||
| LRR 10 | 290..311 | 7/21 (33%) | |||
| leucine-rich repeat | 291..313 | CDD:275380 | 7/22 (32%) | ||
| LRR 11 | 313..335 | 8/22 (36%) | |||
| leucine-rich repeat | 314..336 | CDD:275380 | 8/22 (36%) | ||
| LRR 12 | 336..357 | 6/15 (40%) | |||
| leucine-rich repeat | 337..355 | CDD:275380 | 6/14 (43%) | ||
| leucine-rich repeat | 363..476 | CDD:275380 | |||
| LRR 13 | 429..450 | ||||
| LRR 14 | 453..475 | ||||
| LRR 15 | 476..497 | ||||
| leucine-rich repeat | 477..522 | CDD:275380 | |||
| LRR 16 | 499..520 | ||||
| leucine-rich repeat | 500..513 | CDD:275380 | |||
| LRR 17 | 522..543 | ||||
| leucine-rich repeat | 523..546 | CDD:275380 | |||
| LRR 18 | 546..567 | ||||
| leucine-rich repeat | 547..569 | CDD:275380 | |||
| LRR 19 | 569..590 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||