Sequence 1: | NP_001356954.1 | Gene: | haf / 33339 | FlyBaseID: | FBgn0261509 | Length: | 1347 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611561.1 | Gene: | Lapsyn / 37418 | FlyBaseID: | FBgn0034602 | Length: | 343 | Species: | Drosophila melanogaster |
Alignment Length: | 260 | Identity: | 57/260 - (21%) |
---|---|---|---|
Similarity: | 107/260 - (41%) | Gaps: | 83/260 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 CAY-NLGRELSVQCDQVDFSQLLAAMNTHARLKPVDLLYVNNSTISELPDAVFSNLSLHNLQLSS 113
Fly 114 CGIQRIATGAFKGQESVLRNLNLQDNLLADVPVEALKVLGKLNLLDLSKNQLSHIPDDAFVGLTK 178
Fly 179 LSTLKLNDNNVTLASNAFRGLEQSLKNLNLKGTKQRKVPESIRGLKSLAFLDLSQNGIKELPGAG 243
Fly 244 GIRVFDGLDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLNNLLAEFPIGAVHSLKELRVLDI 308
Fly 309 308 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
haf | NP_001356954.1 | LRR | <52..>252 | CDD:227223 | 45/200 (23%) |
leucine-rich repeat | 86..105 | CDD:275380 | 3/18 (17%) | ||
leucine-rich repeat | 106..129 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 131..189 | CDD:338972 | 20/57 (35%) | ||
leucine-rich repeat | 131..154 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 155..178 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 179..202 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 203..225 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 226..253 | CDD:275380 | 7/26 (27%) | ||
LRR_8 | 254..337 | CDD:338972 | 10/55 (18%) | ||
leucine-rich repeat | 254..302 | CDD:275380 | 7/47 (15%) | ||
leucine-rich repeat | 303..326 | CDD:275380 | 3/6 (50%) | ||
leucine-rich repeat | 327..350 | CDD:275380 | |||
PCC | 332..>413 | CDD:188093 | |||
PRK10927 | <1061..>1097 | CDD:236797 | |||
Lapsyn | NP_611561.1 | leucine-rich repeat | 39..59 | CDD:275380 | 5/45 (11%) |
LRR_8 | 58..118 | CDD:290566 | 19/62 (31%) | ||
leucine-rich repeat | 60..83 | CDD:275380 | 6/25 (24%) | ||
leucine-rich repeat | 84..107 | CDD:275380 | 7/22 (32%) | ||
LRR_RI | <94..>249 | CDD:238064 | 39/168 (23%) | ||
LRR_8 | 106..167 | CDD:290566 | 21/82 (26%) | ||
LRR_4 | 106..145 | CDD:289563 | 14/53 (26%) | ||
leucine-rich repeat | 108..130 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 131..154 | CDD:275380 | 7/41 (17%) | ||
leucine-rich repeat | 157..178 | CDD:275380 | 7/26 (27%) | ||
leucine-rich repeat | 179..202 | CDD:275380 | 7/47 (15%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24366 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |