DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment haf and ISLR

DIOPT Version :9

Sequence 1:NP_001356954.1 Gene:haf / 33339 FlyBaseID:FBgn0261509 Length:1347 Species:Drosophila melanogaster
Sequence 2:NP_005536.1 Gene:ISLR / 3671 HGNCID:6133 Length:428 Species:Homo sapiens


Alignment Length:381 Identity:91/381 - (23%)
Similarity:143/381 - (37%) Gaps:49/381 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 LASNAFRGLEQSLKNLNLKGTKQRKVPESIRGLKSLAFLDLSQNGIKELP-GAGGIRVFDGLDAL 254
            :|..|:|.||              .||.....  ::..|.||.|.:..|| ||     |..:..|
Human    33 IADCAYRDLE--------------SVPPGFPA--NVTTLSLSANRLPGLPEGA-----FREVPLL 76

  Fly   255 TALNLERNLIQSIGETAFAGVRKTLSSLSLLNNLLAEFPIGAVHSLKELRVLDIGFNLLTSLPEA 319
            .:|.|..|.|:::...|.|.: ..|.||.|.:||:::|....:|:|..|::|.:..|.||.:|..
Human    77 QSLWLAHNEIRTVAAGALASL-SHLKSLDLSHNLISDFAWSDLHNLSALQLLKMDSNELTFIPRD 140

  Fly   320 AFRGNPGITLLALDGNPLSSVPEGAFAHLNATLRGLSLGGRFLHCDCKLRWVAEWIRNGDLQVTS 384
            |||....:..|.|:.|.|.::.||.|..|.| |..|.:......|.|.:.|:..|...  ..|:.
Human   141 AFRSLRALRSLQLNHNRLHTLAEGTFTPLTA-LSHLQINENPFDCTCGIVWLKTWALT--TAVSI 202

  Fly   385 RERNPQFCGTPPRFRDRGFYSIQPEELSCPDIADAALRGPVGLADNLKPTLPSSPDSVEYETGTG 449
            .|::...|.:|...:......:.|...|.|.:               :.:...|.|..|...|..
Human   203 PEQDNIACTSPHVLKGTPLSRLPPLPCSAPSV---------------QLSYQPSQDGAELRPGFV 252

  Fly   450 TGTVGTGTAASAPVTS---SVSSSTSTTTPTTTTTTTTAEPTTRRSTTRPPTKSTTTISATTASP 511
            ...........||...   .:.|.....|.....|...|.|.|..::::|  :.....:.:...|
Human   253 LALHCDVDGQPAPQLHWHIQIPSGIVEITSPNVGTDGRALPGTPVASSQP--RFQAFANGSLLIP 315

  Fly   512 ASNPPVNGTGTVQATSITTSSSSSSSSSTSTGHGNGKQAPGWRQGVTNGNGNSGVG 567
            .......||.:..||:...|:.||...:.:|....|:...|.|   .:|....|.|
Human   316 DFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRR---FHGKAVEGKG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hafNP_001356954.1 LRR <52..>252 CDD:227223 16/61 (26%)
leucine-rich repeat 86..105 CDD:275380
leucine-rich repeat 106..129 CDD:275380
LRR_8 131..189 CDD:338972
leucine-rich repeat 131..154 CDD:275380
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..202 CDD:275380 5/10 (50%)
leucine-rich repeat 203..225 CDD:275380 2/21 (10%)
leucine-rich repeat 226..253 CDD:275380 9/27 (33%)
LRR_8 254..337 CDD:338972 28/82 (34%)
leucine-rich repeat 254..302 CDD:275380 16/47 (34%)
leucine-rich repeat 303..326 CDD:275380 9/22 (41%)
leucine-rich repeat 327..350 CDD:275380 8/22 (36%)
PCC 332..>413 CDD:188093 19/80 (24%)
PRK10927 <1061..>1097 CDD:236797
ISLRNP_005536.1 leucine-rich repeat 32..51 CDD:275380 7/33 (21%)
LRR_8 51..110 CDD:316378 21/64 (33%)
LRR 1 51..72 9/25 (36%)
leucine-rich repeat 52..75 CDD:275380 9/27 (33%)
LRR 2 75..96 6/20 (30%)
leucine-rich repeat 76..99 CDD:275380 7/23 (30%)
LRR_8 98..158 CDD:316378 21/59 (36%)
LRR 3 99..122 8/22 (36%)
leucine-rich repeat 100..123 CDD:275380 9/22 (41%)
LRR 4 123..144 8/20 (40%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
LRR 5 147..168 7/20 (35%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
PCC 153..>227 CDD:188093 18/76 (24%)
I-set 239..340 CDD:333254 20/102 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.