DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment haf and AT1G54475

DIOPT Version :9

Sequence 1:NP_001356954.1 Gene:haf / 33339 FlyBaseID:FBgn0261509 Length:1347 Species:Drosophila melanogaster
Sequence 2:NP_001320765.1 Gene:AT1G54475 / 28717354 AraportID:AT1G54475 Length:209 Species:Arabidopsis thaliana


Alignment Length:186 Identity:50/186 - (26%)
Similarity:76/186 - (40%) Gaps:37/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LDLSQNGIKELPGAGGIRVFDGLDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLNNLLAEFP 293
            :|||.|   ||.|.....: ..|..|..:||..|.:.|...::|:.: |.:.||.|.:|:|....
plant    25 MDLSSN---ELSGVIPAEL-GSLSKLRVMNLSCNFLSSSIPSSFSNL-KDIESLDLSHNMLQGSI 84

  Fly   294 IGAVHSLKELRVLDIGFNLLTSL----------PEAAFRGNPGI----TLLALDGNPLSSVPEG- 343
            ...:.:|..|.|.|:.:|.|:.:          .|.::.|||.:    |..:.|....|...|. 
plant    85 PQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENG 149

  Fly   344 -------------AFAHLNATLRGLSLGGRF-LHC-DCKLRWVAEWIRNGDLQVTS 384
                         ||...:|:....:|.|.| |.| ||.||  ..|:|..|..:.|
plant   150 GEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLR--RAWLRIVDASIAS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hafNP_001356954.1 LRR <52..>252 CDD:227223 7/22 (32%)
leucine-rich repeat 86..105 CDD:275380
leucine-rich repeat 106..129 CDD:275380
LRR_8 131..189 CDD:338972
leucine-rich repeat 131..154 CDD:275380
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..202 CDD:275380
leucine-rich repeat 203..225 CDD:275380
leucine-rich repeat 226..253 CDD:275380 8/23 (35%)
LRR_8 254..337 CDD:338972 24/96 (25%)
leucine-rich repeat 254..302 CDD:275380 13/47 (28%)
leucine-rich repeat 303..326 CDD:275380 8/32 (25%)
leucine-rich repeat 327..350 CDD:275380 6/40 (15%)
PCC 332..>413 CDD:188093 19/69 (28%)
PRK10927 <1061..>1097 CDD:236797
AT1G54475NP_001320765.1 PLN00113 <25..>130 CDD:215061 30/109 (28%)
leucine-rich repeat 26..45 CDD:275380 8/22 (36%)
leucine-rich repeat 46..69 CDD:275380 6/23 (26%)
leucine-rich repeat 70..93 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.