Sequence 1: | NP_001356954.1 | Gene: | haf / 33339 | FlyBaseID: | FBgn0261509 | Length: | 1347 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_775450.2 | Gene: | Lgr4 / 286994 | RGDID: | 628615 | Length: | 951 | Species: | Rattus norvegicus |
Alignment Length: | 335 | Identity: | 108/335 - (32%) |
---|---|---|---|
Similarity: | 152/335 - (45%) | Gaps: | 58/335 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 LYVNNSTISELPDAVFSNLS------LHNLQLSSCGIQRIATGAFKGQESVLRNLNLQDNLLADV 144
Fly 145 PVEALKVLGKLNLLDLSKNQLSHIPDDAFVGLTKLSTLKLNDNNVTLASN-AFRGLEQ------- 201
Fly 202 ---------------SLKNLNLKGTKQRKVPESI-RGLKSLAFLDLSQNGIKELPGAGGIRVFDG 250
Fly 251 LDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLNNLLAEFPIGAVHSLKELRVLDIGFNLLTS 315
Fly 316 LPEAAFRGNPGITLLALDGNPLSSVPEGAFAHLNATLRGLSLGGRFLHCDCKLRWVAEWIRNGDL 380
Fly 381 QVTSRERNPQ 390 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
haf | NP_001356954.1 | LRR | <52..>252 | CDD:227223 | 64/195 (33%) |
leucine-rich repeat | 86..105 | CDD:275380 | 9/18 (50%) | ||
leucine-rich repeat | 106..129 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 131..189 | CDD:338972 | 24/57 (42%) | ||
leucine-rich repeat | 131..154 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 155..178 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 179..202 | CDD:275380 | 9/45 (20%) | ||
leucine-rich repeat | 203..225 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 226..253 | CDD:275380 | 11/26 (42%) | ||
LRR_8 | 254..337 | CDD:338972 | 32/82 (39%) | ||
leucine-rich repeat | 254..302 | CDD:275380 | 18/47 (38%) | ||
leucine-rich repeat | 303..326 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 327..350 | CDD:275380 | 5/22 (23%) | ||
PCC | 332..>413 | CDD:188093 | 14/59 (24%) | ||
PRK10927 | <1061..>1097 | CDD:236797 | |||
Lgr4 | NP_775450.2 | LRRNT | 29..61 | CDD:214470 | |
LRR 1 | 58..79 | ||||
leucine-rich repeat | 59..82 | CDD:275380 | |||
LRR | <62..301 | CDD:227223 | 45/125 (36%) | ||
LRR 2 | 82..103 | ||||
leucine-rich repeat | 83..106 | CDD:275380 | |||
LRR 3 | 106..127 | ||||
leucine-rich repeat | 107..130 | CDD:275380 | |||
LRR 4 | 130..151 | ||||
leucine-rich repeat | 131..154 | CDD:275380 | |||
LRR 5 | 154..177 | ||||
leucine-rich repeat | 155..178 | CDD:275380 | |||
LRR 6 | 178..199 | 8/16 (50%) | |||
leucine-rich repeat | 179..202 | CDD:275380 | 10/19 (53%) | ||
LRR 7 | 202..223 | 5/25 (20%) | |||
leucine-rich repeat | 203..226 | CDD:275380 | 6/27 (22%) | ||
LRR 8 | 226..247 | 8/22 (36%) | |||
leucine-rich repeat | 227..249 | CDD:275380 | 9/22 (41%) | ||
LRR 9 | 249..270 | 9/20 (45%) | |||
leucine-rich repeat | 250..273 | CDD:275380 | 10/22 (45%) | ||
LRR 10 | 273..294 | 8/20 (40%) | |||
leucine-rich repeat | 274..295 | CDD:275380 | 8/20 (40%) | ||
LRR | 275..>465 | CDD:227223 | 66/201 (33%) | ||
LRR 11 | 320..341 | 7/20 (35%) | |||
leucine-rich repeat | 321..344 | CDD:275378 | 7/22 (32%) | ||
LRR 12 | 344..365 | 11/26 (42%) | |||
LRR_8 | 345..401 | CDD:404697 | 25/62 (40%) | ||
leucine-rich repeat | 345..366 | CDD:275378 | 11/26 (42%) | ||
LRR 13 | 366..387 | 9/20 (45%) | |||
leucine-rich repeat | 367..390 | CDD:275378 | 9/23 (39%) | ||
LRR 14 | 390..411 | 8/20 (40%) | |||
leucine-rich repeat | 391..414 | CDD:275378 | 9/22 (41%) | ||
LRR 15 | 414..435 | 9/23 (39%) | |||
leucine-rich repeat | 415..427 | CDD:275378 | 5/11 (45%) | ||
leucine-rich repeat | 436..461 | CDD:275380 | 7/26 (27%) | ||
7tmA_LGR4 | 539..812 | CDD:320483 | |||
TM helix 1 | 541..565 | CDD:320483 | |||
TM helix 2 | 574..595 | CDD:320483 | |||
TM helix 3 | 619..641 | CDD:320483 | |||
TM helix 4 | 664..680 | CDD:320483 | |||
TM helix 5 | 704..727 | CDD:320483 | |||
TM helix 6 | 746..768 | CDD:320483 | |||
TM helix 7 | 780..805 | CDD:320483 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |