DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment haf and Lgr4

DIOPT Version :9

Sequence 1:NP_001356954.1 Gene:haf / 33339 FlyBaseID:FBgn0261509 Length:1347 Species:Drosophila melanogaster
Sequence 2:NP_775450.2 Gene:Lgr4 / 286994 RGDID:628615 Length:951 Species:Rattus norvegicus


Alignment Length:335 Identity:108/335 - (32%)
Similarity:152/335 - (45%) Gaps:58/335 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYVNNSTISELPDAVFSNLS------LHNLQLSSCGIQRIATGAFKGQESVLRNLNLQDNLLADV 144
            |.:||  ||.:||..|:|||      |||.::.|     ::...|.|.:: |..|:|..|.|.:.
  Rat   184 LALNN--ISSIPDFAFTNLSSLVVLHLHNNKIKS-----LSQHCFDGLDN-LETLDLNYNNLDEF 240

  Fly   145 PVEALKVLGKLNLLDLSKNQLSHIPDDAFVGLTKLSTLKLNDNNVTLASN-AFRGLEQ------- 201
            | :|:|.|..|..|....|.:|.|||.||.|...|.|:.|.||.::...| ||..|..       
  Rat   241 P-QAIKALPSLKELGFHSNSISVIPDGAFGGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIR 304

  Fly   202 ---------------SLKNLNLKGTKQRKVPESI-RGLKSLAFLDLSQNGIKELPGAGGIRVFDG 250
                           .|::|.|.|||...:|:.: :..|.|..||||.|.|::||.      |:|
  Rat   305 GASLVQWFPNLTGTVHLESLTLTGTKISSIPDDLCQNQKMLRTLDLSYNNIRDLPS------FNG 363

  Fly   251 LDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLNNLLAEFPIGAVHSLKELRVLDIGFNLLTS 315
            ..||..::|:||.|..|.|..|.|: .:|..|.|..||:.|...||...|..:..||:.||.|||
  Rat   364 CRALEEISLQRNQISLIKENTFQGL-TSLRILDLSRNLIREIHSGAFAKLGTITNLDVSFNELTS 427

  Fly   316 LPEAAFRGNPGITLLALDGNPLSSVPEGAFAHLNATLRGLSLGGRFLHCDCKLRWVAEWIRNGDL 380
            .|.   .|..|:..|.|.||  ..:.:...|...|.||.||:...:..|       |.|..:...
  Rat   428 FPT---EGLNGLNQLKLVGN--FKLKDALAARDFANLRSLSVPYAYQCC-------AFWGCDSYA 480

  Fly   381 QVTSRERNPQ 390
            .:.:.:.:||
  Rat   481 NLNTEDNSPQ 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hafNP_001356954.1 LRR <52..>252 CDD:227223 64/195 (33%)
leucine-rich repeat 86..105 CDD:275380 9/18 (50%)
leucine-rich repeat 106..129 CDD:275380 6/22 (27%)
LRR_8 131..189 CDD:338972 24/57 (42%)
leucine-rich repeat 131..154 CDD:275380 9/22 (41%)
leucine-rich repeat 155..178 CDD:275380 10/22 (45%)
leucine-rich repeat 179..202 CDD:275380 9/45 (20%)
leucine-rich repeat 203..225 CDD:275380 7/22 (32%)
leucine-rich repeat 226..253 CDD:275380 11/26 (42%)
LRR_8 254..337 CDD:338972 32/82 (39%)
leucine-rich repeat 254..302 CDD:275380 18/47 (38%)
leucine-rich repeat 303..326 CDD:275380 9/22 (41%)
leucine-rich repeat 327..350 CDD:275380 5/22 (23%)
PCC 332..>413 CDD:188093 14/59 (24%)
PRK10927 <1061..>1097 CDD:236797
Lgr4NP_775450.2 LRRNT 29..61 CDD:214470
LRR 1 58..79
leucine-rich repeat 59..82 CDD:275380
LRR <62..301 CDD:227223 45/125 (36%)
LRR 2 82..103
leucine-rich repeat 83..106 CDD:275380
LRR 3 106..127
leucine-rich repeat 107..130 CDD:275380
LRR 4 130..151
leucine-rich repeat 131..154 CDD:275380
LRR 5 154..177
leucine-rich repeat 155..178 CDD:275380
LRR 6 178..199 8/16 (50%)
leucine-rich repeat 179..202 CDD:275380 10/19 (53%)
LRR 7 202..223 5/25 (20%)
leucine-rich repeat 203..226 CDD:275380 6/27 (22%)
LRR 8 226..247 8/22 (36%)
leucine-rich repeat 227..249 CDD:275380 9/22 (41%)
LRR 9 249..270 9/20 (45%)
leucine-rich repeat 250..273 CDD:275380 10/22 (45%)
LRR 10 273..294 8/20 (40%)
leucine-rich repeat 274..295 CDD:275380 8/20 (40%)
LRR 275..>465 CDD:227223 66/201 (33%)
LRR 11 320..341 7/20 (35%)
leucine-rich repeat 321..344 CDD:275378 7/22 (32%)
LRR 12 344..365 11/26 (42%)
LRR_8 345..401 CDD:404697 25/62 (40%)
leucine-rich repeat 345..366 CDD:275378 11/26 (42%)
LRR 13 366..387 9/20 (45%)
leucine-rich repeat 367..390 CDD:275378 9/23 (39%)
LRR 14 390..411 8/20 (40%)
leucine-rich repeat 391..414 CDD:275378 9/22 (41%)
LRR 15 414..435 9/23 (39%)
leucine-rich repeat 415..427 CDD:275378 5/11 (45%)
leucine-rich repeat 436..461 CDD:275380 7/26 (27%)
7tmA_LGR4 539..812 CDD:320483
TM helix 1 541..565 CDD:320483
TM helix 2 574..595 CDD:320483
TM helix 3 619..641 CDD:320483
TM helix 4 664..680 CDD:320483
TM helix 5 704..727 CDD:320483
TM helix 6 746..768 CDD:320483
TM helix 7 780..805 CDD:320483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.