DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment haf and lron-6

DIOPT Version :9

Sequence 1:NP_001356954.1 Gene:haf / 33339 FlyBaseID:FBgn0261509 Length:1347 Species:Drosophila melanogaster
Sequence 2:NP_491851.3 Gene:lron-6 / 185427 WormBaseID:WBGene00018157 Length:594 Species:Caenorhabditis elegans


Alignment Length:429 Identity:97/429 - (22%)
Similarity:164/429 - (38%) Gaps:102/429 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LPLILGRLHVAHAQCPWQRDVPDLQTSCICAYNLG------RELSVQ-----CDQVDFSQLLAAM 74
            ||:|..:.::.:...|:...:.:...|...::.||      ..|:.|     .|.:||.:....:
 Worm    87 LPMICRQPNLPNPDAPYTIVIENSNESLTHSFLLGSCSKTVTSLTFQHYHKLYDSIDFGECFPRL 151

  Fly    75 -------------NTHARLK--------------------------PVDLLYVNNSTISELPDAV 100
                         |.|..|:                          .:..:::.||:|:|||..:
 Worm   152 ASFQVVLLQRTKANFHGSLRNLKNLKVLSLVNVDFDFWLQPSPFINTITYIHIENSSITELPKWL 216

  Fly   101 FSNLSLHNLQLSSCGIQRIATGAFKGQESVLRNLNLQDNLLADVPVEALKVLGKLNLLDLSKNQL 165
            .::.||..:.|....|..:...|   |...:::|.|..||:.::. ..|.|...|..:|||.||:
 Worm   217 STSKSLSTVYLKGTSISSLTPVA---QLPAVKSLKLSHNLIENLH-RLLFVSPFLIHVDLSYNQI 277

  Fly   166 SHIPDDAFVGLTKLSTLKLNDNNVTLASNAFRGLEQSLKNLNLKGTKQRKVPESIRGLKSLAFLD 230
            :......|.....|..|.|..|.:.:..     .:...||:.||                  :|.
 Worm   278 TSFASHTFSKCIDLRVLDLTGNPIKMLP-----YKPFAKNIKLK------------------WLK 319

  Fly   231 LSQNGIKEL-PGAGGIRVFDGLDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLNNLLAEFPI 294
            ||:..|..| |..     |.||:||..|:|.|..||||...:|..: |:|..|.:.:..|.:.| 
 Worm   320 LSRTNITTLTPDH-----FYGLNALKTLSLSRMPIQSISPYSFVPL-KSLRYLDMDSCNLTKIP- 377

  Fly   295 GAVHSLKELRVLDIGFNLL---TSLPEAAFRGNPGITLLALDGNPLSSVPEGAFAHLNATLRGLS 356
            .||.:...|..|::..|:|   :|:|........|::.|.::||||:..|.   :.|..:.....
 Worm   378 QAVTANCHLARLNVANNMLHRSSSMPPEVMAMLSGLSQLRIEGNPLTEFPA---SFLLISRENFR 439

  Fly   357 LGGRFLHCDCKLR-WVAE------WIRNGDLQVTSRERN 388
            |..:.||....|. |:.|      |    .:.:.:|..|
 Worm   440 LLRQLLHSTMTLPVWLREPCTPYYW----SMHLANRTNN 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hafNP_001356954.1 LRR <52..>252 CDD:227223 51/250 (20%)
leucine-rich repeat 86..105 CDD:275380 6/18 (33%)
leucine-rich repeat 106..129 CDD:275380 5/22 (23%)
LRR_8 131..189 CDD:338972 17/57 (30%)
leucine-rich repeat 131..154 CDD:275380 6/22 (27%)
leucine-rich repeat 155..178 CDD:275380 7/22 (32%)
leucine-rich repeat 179..202 CDD:275380 4/22 (18%)
leucine-rich repeat 203..225 CDD:275380 4/21 (19%)
leucine-rich repeat 226..253 CDD:275380 9/27 (33%)
LRR_8 254..337 CDD:338972 26/85 (31%)
leucine-rich repeat 254..302 CDD:275380 16/47 (34%)
leucine-rich repeat 303..326 CDD:275380 6/25 (24%)
leucine-rich repeat 327..350 CDD:275380 7/22 (32%)
PCC 332..>413 CDD:188093 15/64 (23%)
PRK10927 <1061..>1097 CDD:236797
lron-6NP_491851.3 leucine-rich repeat 200..221 CDD:275380 6/20 (30%)
leucine-rich repeat 222..243 CDD:275380 5/23 (22%)
LRR_8 242..301 CDD:290566 17/59 (29%)
leucine-rich repeat 244..265 CDD:275380 6/21 (29%)
leucine-rich repeat 267..290 CDD:275380 7/22 (32%)
leucine-rich repeat 291..314 CDD:275380 6/27 (22%)
LRR_8 314..373 CDD:290566 24/82 (29%)
leucine-rich repeat 315..338 CDD:275380 11/45 (24%)
leucine-rich repeat 339..362 CDD:275380 9/23 (39%)
leucine-rich repeat 363..385 CDD:275380 6/22 (27%)
leucine-rich repeat 386..412 CDD:275380 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.