DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment haf and lrg1

DIOPT Version :9

Sequence 1:NP_001356954.1 Gene:haf / 33339 FlyBaseID:FBgn0261509 Length:1347 Species:Drosophila melanogaster
Sequence 2:XP_004911101.1 Gene:lrg1 / 116406453 XenbaseID:XB-GENE-984373 Length:372 Species:Xenopus tropicalis


Alignment Length:416 Identity:100/416 - (24%)
Similarity:155/416 - (37%) Gaps:112/416 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLLLLPLILGRLHVAHAQCPWQRDVPDLQTSCICAYNLGREL-SVQCD--------QVDFSQLLA 72
            :::.:|..||......:.|   .....|..|.:|   :.||| |..|.        .|:|:.:.:
 Frog    47 VVIFIPSALGLTDPCPSLC---NCTSSLNISVVC---ISRELDSFPCSFPLHTISISVEFTNITS 105

  Fly    73 AMN-THARLKPVDLLYVNNSTISELPDAVFSNL-SLHNLQLSSCGIQRIATGAFKGQESVLRNLN 135
            ..| :.:.|..:..|:::|:.:..||...|..| |||.|.|::..||.:....|. ....||.|.
 Frog   106 LCNGSFSELPNLQELHLSNNALQSLPIQFFVPLSSLHTLDLTNNLIQSVTPTLFL-DVPALRFLV 169

  Fly   136 LQDNLLADVPVEALKVLGKLNLLDLSKNQLSHIPDDAFVGLTKLSTLKLNDNNVTLASNAFRGLE 200
            |:.|||..:.:..:.:|..||.||||.|.|..:                  |:::.:|       
 Frog   170 LRGNLLTKLWISKISILKNLNWLDLSHNHLKEV------------------NSMSFSS------- 209

  Fly   201 QSLKNLNLKGTKQRKVPESIRGLKSLAFLDLSQNGIKELPGAGGIRVFDGLDALTALNLERNLIQ 265
                                  |.:|..||||.|.:.:||.:    :..||..|..||||.|.:.
 Frog   210 ----------------------LNNLENLDLSYNQLHQLPSS----LLKGLPLLQRLNLEGNNLS 248

  Fly   266 SIGETAFAGVRKTLSSLSLLNNLLAEFPIGAVHSLKELRVLDIGFNLLTSLPEAAFRGNPGIT-- 328
            |:....||.. ..|..:.|..|.|...|.|.:..:..|:.||:..|:|.|||......:.|:.  
 Frog   249 SLPSDFFAAT-PFLKHVFLARNSLHFLPKGLLLPVMSLKTLDLSENMLKSLPSGFLLESKGLNDS 312

  Fly   329 ---LLALDGNPLSSVPEGAFAHLNATLRGLSLGGRFLHCDCKLRWVAEWIRNGDLQVTSRERNPQ 390
               .|.|..||                         .||||.|..:.:|       ||..:....
 Frog   313 MEQTLDLSNNP-------------------------WHCDCHLLSLHQW-------VTKHKHTLY 345

  Fly   391 F-----CGTPPRFRDRGFYSIQPEEL 411
            |     |..|...::|..:.:...:|
 Frog   346 FIDNTQCAGPGALKNRTLHQVTEVDL 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hafNP_001356954.1 LRR <52..>252 CDD:227223 51/210 (24%)
leucine-rich repeat 86..105 CDD:275380 6/19 (32%)
leucine-rich repeat 106..129 CDD:275380 7/22 (32%)
LRR_8 131..189 CDD:338972 17/57 (30%)
leucine-rich repeat 131..154 CDD:275380 8/22 (36%)
leucine-rich repeat 155..178 CDD:275380 8/22 (36%)
leucine-rich repeat 179..202 CDD:275380 2/22 (9%)
leucine-rich repeat 203..225 CDD:275380 1/21 (5%)
leucine-rich repeat 226..253 CDD:275380 10/26 (38%)
LRR_8 254..337 CDD:338972 27/87 (31%)
leucine-rich repeat 254..302 CDD:275380 15/47 (32%)
leucine-rich repeat 303..326 CDD:275380 8/22 (36%)
leucine-rich repeat 327..350 CDD:275380 4/27 (15%)
PCC 332..>413 CDD:188093 16/85 (19%)
PRK10927 <1061..>1097 CDD:236797
lrg1XP_004911101.1 LRR_RI 115..322 CDD:238064 69/259 (27%)
LRR_8 115..175 CDD:290566 19/60 (32%)
leucine-rich repeat 117..140 CDD:275380 6/22 (27%)
leucine-rich repeat 141..164 CDD:275380 7/23 (30%)
leucine-rich repeat 165..188 CDD:275380 8/22 (36%)
LRR_8 187..247 CDD:290566 27/110 (25%)
leucine-rich repeat 189..212 CDD:275380 11/69 (16%)
leucine-rich repeat 213..236 CDD:275380 10/26 (38%)
LRR_8 235..295 CDD:290566 19/60 (32%)
leucine-rich repeat 237..260 CDD:275380 9/23 (39%)
leucine-rich repeat 261..284 CDD:275380 6/22 (27%)
LRRCT 322..372 CDD:214507 15/82 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.