| Sequence 1: | NP_001356954.1 | Gene: | haf / 33339 | FlyBaseID: | FBgn0261509 | Length: | 1347 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_766259.2 | Gene: | Lgr4 / 107515 | MGIID: | 1891468 | Length: | 951 | Species: | Mus musculus |
| Alignment Length: | 335 | Identity: | 109/335 - (32%) |
|---|---|---|---|
| Similarity: | 153/335 - (45%) | Gaps: | 58/335 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 86 LYVNNSTISELPDAVFSNLS------LHNLQLSSCGIQRIATGAFKGQESVLRNLNLQDNLLADV 144
Fly 145 PVEALKVLGKLNLLDLSKNQLSHIPDDAFVGLTKLSTLKLNDNNVTLASN-AFRGLEQ------- 201
Fly 202 ---------------SLKNLNLKGTKQRKVPESI-RGLKSLAFLDLSQNGIKELPGAGGIRVFDG 250
Fly 251 LDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLNNLLAEFPIGAVHSLKELRVLDIGFNLLTS 315
Fly 316 LPEAAFRGNPGITLLALDGNPLSSVPEGAFAHLNATLRGLSLGGRFLHCDCKLRWVAEWIRNGDL 380
Fly 381 QVTSRERNPQ 390 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| haf | NP_001356954.1 | LRR | <52..>252 | CDD:227223 | 64/195 (33%) |
| leucine-rich repeat | 86..105 | CDD:275380 | 9/18 (50%) | ||
| leucine-rich repeat | 106..129 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 131..189 | CDD:338972 | 24/57 (42%) | ||
| leucine-rich repeat | 131..154 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 155..178 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 179..202 | CDD:275380 | 9/45 (20%) | ||
| leucine-rich repeat | 203..225 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 226..253 | CDD:275380 | 11/26 (42%) | ||
| LRR_8 | 254..337 | CDD:338972 | 33/82 (40%) | ||
| leucine-rich repeat | 254..302 | CDD:275380 | 19/47 (40%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 5/22 (23%) | ||
| PCC | 332..>413 | CDD:188093 | 14/59 (24%) | ||
| PRK10927 | <1061..>1097 | CDD:236797 | |||
| Lgr4 | NP_766259.2 | LRRNT | 29..61 | CDD:214470 | |
| LRR 1 | 58..79 | ||||
| leucine-rich repeat | 59..82 | CDD:275380 | |||
| LRR 2 | 82..103 | ||||
| LRR_RI | 83..375 | CDD:238064 | 67/205 (33%) | ||
| LRR_8 | 83..141 | CDD:290566 | |||
| leucine-rich repeat | 83..106 | CDD:275380 | |||
| LRR 3 | 106..127 | ||||
| leucine-rich repeat | 107..130 | CDD:275380 | |||
| LRR 4 | 130..151 | ||||
| leucine-rich repeat | 131..154 | CDD:275380 | |||
| LRR 5 | 154..177 | ||||
| leucine-rich repeat | 155..178 | CDD:275380 | |||
| LRR_8 | 177..237 | CDD:290566 | 21/60 (35%) | ||
| LRR 6 | 178..199 | 8/16 (50%) | |||
| leucine-rich repeat | 179..202 | CDD:275380 | 10/19 (53%) | ||
| LRR 7 | 202..223 | 5/25 (20%) | |||
| leucine-rich repeat | 203..226 | CDD:275380 | 6/27 (22%) | ||
| LRR 8 | 226..247 | 8/22 (36%) | |||
| leucine-rich repeat | 227..249 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 248..305 | CDD:290566 | 19/56 (34%) | ||
| LRR 9 | 249..270 | 9/20 (45%) | |||
| leucine-rich repeat | 250..273 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 272..355 | CDD:290566 | 23/82 (28%) | ||
| LRR 10 | 273..294 | 8/20 (40%) | |||
| leucine-rich repeat | 274..295 | CDD:275380 | 8/20 (40%) | ||
| LRR 11 | 320..341 | 7/20 (35%) | |||
| leucine-rich repeat | 321..344 | CDD:275380 | 7/22 (32%) | ||
| LRR 12 | 344..365 | 11/26 (42%) | |||
| leucine-rich repeat | 345..366 | CDD:275380 | 11/26 (42%) | ||
| LRR_8 | 365..425 | CDD:290566 | 24/60 (40%) | ||
| LRR 13 | 366..387 | 10/20 (50%) | |||
| leucine-rich repeat | 367..390 | CDD:275380 | 10/23 (43%) | ||
| LRR | 388..410 | CDD:197688 | 8/22 (36%) | ||
| LRR 14 | 390..411 | 8/20 (40%) | |||
| leucine-rich repeat | 391..414 | CDD:275380 | 9/22 (41%) | ||
| LRR 15 | 414..435 | 9/23 (39%) | |||
| leucine-rich repeat | 415..438 | CDD:275380 | 10/25 (40%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 487..512 | 2/4 (50%) | |||
| 7tm_1 | 556..801 | CDD:278431 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||