DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment haf and waif2

DIOPT Version :9

Sequence 1:NP_001356954.1 Gene:haf / 33339 FlyBaseID:FBgn0261509 Length:1347 Species:Drosophila melanogaster
Sequence 2:NP_001245160.1 Gene:waif2 / 100884149 ZFINID:ZDB-GENE-120209-3 Length:313 Species:Danio rerio


Alignment Length:399 Identity:93/399 - (23%)
Similarity:135/399 - (33%) Gaps:155/399 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AQCPWQRDVPDLQTSCICAYNLGRELSVQCDQVDFSQLLAAMNTHARLKPVDLLYVNNSTISELP 97
            ||||:         :|.| :|    .||.|:  |..::...:....|   ..:|.:||..:|.|.
Zfish    10 AQCPF---------NCTC-FN----RSVMCE--DSDEIKLPLEVPRR---TQILTLNNVNMSVLI 55

  Fly    98 DAVFS----NL-SLHNLQLSSCGIQRIATGAFKGQESVLRNLNLQDNLLADVPVEALKVLGKLNL 157
            :..||    |. |||.|.|....||.|.:.||.|                         |.:|:|
Zfish    56 ERAFSANGTNAHSLHELSLRDNNIQVIQSCAFCG-------------------------LHRLHL 95

  Fly   158 LDLSKNQLSHIPDDAFVGLTKLSTLKLNDNNVTLASNAFRGLEQSLKNLNLKGTKQRKVPESIRG 222
            ||||:|:|..:..:||..|.:|..|.|:.......:|.......||.||.:              
Zfish    96 LDLSRNRLEDVHPEAFSELNQLRNLNLSYTLTAAGANQLSSALDSLSNLQI-------------- 146

  Fly   223 LKSLAFLDLSQNGIKELPGAGGIRVFDGLDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLNN 287
                  ||||.|.:|.:|.:|     .|..:||.|||..|.|            .||.:..|.. 
Zfish   147 ------LDLSGNRLKTIPLSG-----FGKFSLTMLNLTHNSI------------TTLDTNELTK- 187

  Fly   288 LLAEFPIGAVHSLKELRVLDIGFNLLTSLPEAAFRGNPGITLLALDGNPLSSVPEGAFAHLNATL 352
             |:|:        :|:||.                         |..||..              
Zfish   188 -LSEY--------REMRVY-------------------------LSHNPFD-------------- 204

  Fly   353 RGLSLGGRFLHCDC-KLRWVAEWIRNGDLQVTSRERNPQFCGTPPRFRDRGFYSIQPEELSCPDI 416
                       |.| :||...:|::|......|:...   |..|...:|     ::.|.:.|.::
Zfish   205 -----------CRCDRLREFHDWLKNSSQCADSKNLR---CALPKVQKD-----LRVESVDCKNV 250

  Fly   417 ADAALRGPV 425
            ....|.|.|
Zfish   251 GSFVLLGIV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hafNP_001356954.1 LRR <52..>252 CDD:227223 54/204 (26%)
leucine-rich repeat 86..105 CDD:275380 8/23 (35%)
leucine-rich repeat 106..129 CDD:275380 10/22 (45%)
LRR_8 131..189 CDD:338972 15/57 (26%)
leucine-rich repeat 131..154 CDD:275380 1/22 (5%)
leucine-rich repeat 155..178 CDD:275380 11/22 (50%)
leucine-rich repeat 179..202 CDD:275380 4/22 (18%)
leucine-rich repeat 203..225 CDD:275380 3/21 (14%)
leucine-rich repeat 226..253 CDD:275380 9/26 (35%)
LRR_8 254..337 CDD:338972 17/82 (21%)
leucine-rich repeat 254..302 CDD:275380 12/47 (26%)
leucine-rich repeat 303..326 CDD:275380 2/22 (9%)
leucine-rich repeat 327..350 CDD:275380 3/22 (14%)
PCC 332..>413 CDD:188093 14/81 (17%)
PRK10927 <1061..>1097 CDD:236797
waif2NP_001245160.1 LRRNT 11..42 CDD:214470 11/49 (22%)
leucine-rich repeat 42..68 CDD:275380 8/25 (32%)
LRR_RI <68..156 CDD:238064 36/132 (27%)
LRR_8 68..126 CDD:290566 26/82 (32%)
leucine-rich repeat 69..92 CDD:275380 11/47 (23%)
leucine-rich repeat 93..116 CDD:275380 11/22 (50%)
leucine-rich repeat 117..143 CDD:275380 6/25 (24%)
LRR_8 142..203 CDD:290566 28/132 (21%)
LRR_4 143..182 CDD:289563 20/75 (27%)
leucine-rich repeat 144..166 CDD:275380 10/46 (22%)
leucine-rich repeat 167..190 CDD:275380 11/36 (31%)
TPKR_C2 201..246 CDD:301599 13/77 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.