DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment haf and rtn4rl2

DIOPT Version :9

Sequence 1:NP_001356954.1 Gene:haf / 33339 FlyBaseID:FBgn0261509 Length:1347 Species:Drosophila melanogaster
Sequence 2:XP_017951401.1 Gene:rtn4rl2 / 100498486 XenbaseID:XB-GENE-6036061 Length:396 Species:Xenopus tropicalis


Alignment Length:402 Identity:115/402 - (28%)
Similarity:167/402 - (41%) Gaps:65/402 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PVDLLYVNNSTISELPDAVFSNLSLHNL----------QLSSCGIQRIATGAFKGQESVLRNLNL 136
            ||.|.|:...:|. ||.:..|..||...          ..:||....::...|....|..| |.|
 Frog    12 PVSLCYLICFSII-LPFSFCSAPSLFTCPTLCTCYPSPPTASCQSHNLSRVPFPLPSSAQR-LFL 74

  Fly   137 QDNLLADVPVEALKVLGKLNLLDLSKNQLSHIPDDAFVGLTKLSTLKLNDNN--VTLASNAFRGL 199
            |:|.::::.......|  .::|.|..|.:|.:...||.||..|..|.|.:|.  ..|.|:.|.||
 Frog    75 QNNHISEIGPGLFSPL--TSVLWLFSNHISILHPGAFNGLENLEELDLGNNPKFPILQSDTFEGL 137

  Fly   200 EQSLKNLNLKGTKQRKVPESI-RGLKSLAFLDLSQNGIKELPGAGGIRVFDGLDALTALNLERNL 263
             :||::|:|......::|..: |||.||.:|.|..|.:..||..    :|..|..||.|.|..||
 Frog   138 -KSLRSLHLYHCHINRLPSGLFRGLYSLRYLYLQNNRLTVLPDG----LFRDLFNLTQLFLYGNL 197

  Fly   264 IQSIGETAFAGVRKTLSSLSLLNNLLAEFPIGAVHSLKELRVLDIGFNLLTSLPEAAFRGNPGIT 328
            :||:...:|.|       ||.|:.||       :||           |.|..:...||||...:|
 Frog   198 LQSLPAESFFG-------LSNLDRLL-------LHS-----------NQLAVVSPGAFRGLKSLT 237

  Fly   329 LLALDGNPLSSVPEGAFAHLNATLRGLSLGGRFLHCDCKLRWVAEWIRNGDLQVTSRERNPQFCG 393
            :|.|..|.|.::|......| .:|:.|.|.....||||..|.:..|..:    ......:|..|.
 Frog   238 MLYLFNNSLPTLPGDCLQPL-TSLQFLRLNENPWHCDCSCRSLWRWFHS----TPGVSSSPVTCN 297

  Fly   394 TPPRFRDRGFYSIQPEELSCPDIADAALRGPVGLADNLKPTLPSS------PDSVEYETGTGTGT 452
            :||..:.|....:...:|.......:...|  .|:|...|..|||      |.:| .|.|....|
 Frog   298 SPPPLKGRDLRFLVERDLRFCTSNISPRNG--NLSDLAFPHKPSSFYIQGDPGAV-LEAGEWENT 359

  Fly   453 V----GTGTAAS 460
            :    |:|.:||
 Frog   360 IEEGGGSGQSAS 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hafNP_001356954.1 LRR <52..>252 CDD:227223 53/182 (29%)
leucine-rich repeat 86..105 CDD:275380 5/18 (28%)
leucine-rich repeat 106..129 CDD:275380 4/32 (13%)
LRR_8 131..189 CDD:338972 18/59 (31%)
leucine-rich repeat 131..154 CDD:275380 6/22 (27%)
leucine-rich repeat 155..178 CDD:275380 8/22 (36%)
leucine-rich repeat 179..202 CDD:275380 9/24 (38%)
leucine-rich repeat 203..225 CDD:275380 7/22 (32%)
leucine-rich repeat 226..253 CDD:275380 8/26 (31%)
LRR_8 254..337 CDD:338972 27/82 (33%)
leucine-rich repeat 254..302 CDD:275380 17/47 (36%)
leucine-rich repeat 303..326 CDD:275380 6/22 (27%)
leucine-rich repeat 327..350 CDD:275380 7/22 (32%)
PCC 332..>413 CDD:188093 20/80 (25%)
PRK10927 <1061..>1097 CDD:236797
rtn4rl2XP_017951401.1 PLN00113 46..>268 CDD:215061 77/255 (30%)
leucine-rich repeat 69..92 CDD:275380 6/25 (24%)
leucine-rich repeat 93..114 CDD:275380 8/20 (40%)
leucine-rich repeat 115..139 CDD:275380 9/24 (38%)
leucine-rich repeat 140..163 CDD:275380 7/22 (32%)
LRR_8 163..222 CDD:338972 27/87 (31%)
leucine-rich repeat 164..187 CDD:275380 8/26 (31%)
leucine-rich repeat 188..211 CDD:275380 11/29 (38%)
leucine-rich repeat 212..235 CDD:275380 11/40 (28%)
leucine-rich repeat 236..259 CDD:275380 7/23 (30%)
TPKR_C2 268..310 CDD:387596 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.