DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment haf and nyx

DIOPT Version :9

Sequence 1:NP_001356954.1 Gene:haf / 33339 FlyBaseID:FBgn0261509 Length:1347 Species:Drosophila melanogaster
Sequence 2:XP_031752664.1 Gene:nyx / 100495354 XenbaseID:XB-GENE-949924 Length:468 Species:Xenopus tropicalis


Alignment Length:483 Identity:128/483 - (26%)
Similarity:194/483 - (40%) Gaps:100/483 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HAQCPWQRDVPDLQTSCICAYNLGRELSVQCDQVDFSQLLAAMNTHARLKPVDLLYVN--NSTIS 94
            :..||         ::|:|...  |..||.||::...::       .:..|.:..::|  .:.|.
 Frog    26 YRSCP---------SNCVCTQE--RSCSVLCDRIGLPEI-------PKEFPCEASFINLDKNNIK 72

  Fly    95 ELPDAVFSNLS-LHNLQLSSCGIQRIATGAFKGQESVLRNLNLQDNLLADVPVEALKVLGKLNLL 158
            .|.:..|..|. |..|.||...|..|..|||||..::.......:..:..:......||.||..|
 Frog    73 FLYERAFGTLPLLKGLSLSHNNISFITPGAFKGLPNLTELKMAHNEYIRYLHTRTFSVLKKLVKL 137

  Fly   159 DLSKNQLSHIPDDAFVGLTKLSTLKLNDNNVTLASNAFRGLEQSLKNLNLKGTKQRKVPESIRGL 223
            ||:...|.:|||..||.|..|..|....||.                        |::|.:|||:
 Frog   138 DLADCNLFNIPDRIFVELPSLHELIFFQNNF------------------------RRIPGAIRGM 178

  Fly   224 KSLAFLDLSQNGIKELPGAGGIRVFDGLDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLNNL 288
            ::|..:.|..|.|:    |........|..|..|||:.|.|..|.:.:|...:| |..|.|.:||
 Frog   179 ENLTHIYLESNRIE----AVAYNSLQDLINLKYLNLQDNKINVIHDRSFQDCQK-LEYLYLNDNL 238

  Fly   289 LAEFPIGAVHSLKELRVLDIGFNLLTSLPEAAFRGNPGITLLALDGNPLSSVPEGAF-------- 345
            |.|.|..:...||.|::|::|.|.:.::..|.|:....:.:|.||.|.:|.:.||||        
 Frog   239 LNELPENSFKGLKCLKMLNLGGNFIRNVSSAWFQDLVELEVLYLDRNRISYIEEGAFENLTSLVT 303

  Fly   346 AHLNA-TLRGLS---------LGGRFL-----HCDCKLRWVAEWIRNGDLQVTSRERNPQFCGTP 395
            .|||: .|..|.         ||..||     .|||:::|:.:|:.|..|     .|:.. |..|
 Frog   304 LHLNSNNLTTLPFEVFRPVYFLGRLFLFRNPWECDCRIKWLQDWMDNYKL-----VRDVP-CSAP 362

  Fly   396 PRFRDRGFYSI---QPEELSCPDIADAALRGPVGL-ADNLKPTLPSSPDSV---------EYE-- 445
            .........||   :.::..|.|..|......|.| .|.|:.|:.:...|:         .||  
 Frog   363 ALVAGMDLSSILLKKSQDGVCLDPTDENFTYFVPLPTDGLQSTMETKLSSLISRLLLPKGNYEAS 427

  Fly   446 ---TGTGTGTV---GTGTAASAPVTSSV 467
               |.:...|.   |..||:|..::..|
 Frog   428 GNITDSSDNTTLSDGKNTASSLDLSQKV 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hafNP_001356954.1 LRR <52..>252 CDD:227223 50/202 (25%)
leucine-rich repeat 86..105 CDD:275380 4/20 (20%)
leucine-rich repeat 106..129 CDD:275380 11/22 (50%)
LRR_8 131..189 CDD:338972 17/57 (30%)
leucine-rich repeat 131..154 CDD:275380 2/22 (9%)
leucine-rich repeat 155..178 CDD:275380 11/22 (50%)
leucine-rich repeat 179..202 CDD:275380 4/22 (18%)
leucine-rich repeat 203..225 CDD:275380 5/21 (24%)
leucine-rich repeat 226..253 CDD:275380 6/26 (23%)
LRR_8 254..337 CDD:338972 29/82 (35%)
leucine-rich repeat 254..302 CDD:275380 18/47 (38%)
leucine-rich repeat 303..326 CDD:275380 6/22 (27%)
leucine-rich repeat 327..350 CDD:275380 11/30 (37%)
PCC 332..>413 CDD:188093 29/106 (27%)
PRK10927 <1061..>1097 CDD:236797
nyxXP_031752664.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.