DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10869 and CG10589

DIOPT Version :9

Sequence 1:NP_608605.1 Gene:CG10869 / 33337 FlyBaseID:FBgn0031347 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_649269.1 Gene:CG10589 / 40313 FlyBaseID:FBgn0037035 Length:386 Species:Drosophila melanogaster


Alignment Length:374 Identity:70/374 - (18%)
Similarity:148/374 - (39%) Gaps:112/374 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 LTSQLKITMEQ-------VNNMTHLLIDRKPNPQRFRLLRHIAKQLRVLMVTTGDEVSVSWSSGD 305
            :.:.|.:|:|:       |..:||:.:         .:|:.:...|...:....|.|.:|...|.
  Fly     1 MPAHLDLTLEEMTRIALGVPELTHVNV---------AVLQSLLNVLLKKLNCQNDMVRISGFEGK 56

  Fly   306 IVDGV-EEEGLSEEEVPVESSAP--------TEVEKPEEEEELELEQPLCYSPE-KMLTELLDLK 360
            .::.: |:..:|.....||:..|        .|::|..::.|.:||   |:..: ::..:..|.|
  Fly    57 CMERILEQSKISPLPFDVEAIVPISEQLDKVQELDKRIKQLECKLE---CHFQQIRICNKAKDKK 118

  Fly   361 -------------SQFCALTNKVNELAAALL----------KQDSQRLMDQMKDLSETVRDIKLY 402
                         ...|.:.::.|::|.:||          ::.:..::|:|:::|..:....|.
  Fly   119 YKINQAEQYASPCEDLCTVCDEDNKIACSLLANMDFMKKLMRRIATPILDRMEEVSHKLEKFYLT 183

  Fly   403 MASNKEATNGMMTRL---NDCVYQIQVLKKSASHLDEVKIDKTEVELLLAEKVDFQQLATKVSLE 464
            :.:..:.|..:..||   ..||.:|:.|:                  .|.::.:...|.|   :|
  Fly   184 LEAFLKQTEALFNRLEIVKQCVVEIEGLR------------------TLVQEYNLTFLGT---ME 227

  Fly   465 QLEEYKARLEQMFCEVRHIVSLNEKNVLQIIDNLRMTLGIDALELSLKDFREMIERRVQIIAEAL 529
            :|::                .|:.|     :|.:.|    .||:..::|..:.|:||:::|.:  
  Fly   228 ELQD----------------MLDSK-----LDKVHM----PALKKYIRDRFDDIDRRLRLIED-- 265

  Fly   530 QKYMEMTNDDCAAAAGRVKVMQDLACLACDTTCVMRTVERSKVPSLPNA 578
                   .|.|..|||.:..  .|:||:|::..|...|....:...|:|
  Fly   266 -------KDACPRAAGFINT--GLSCLSCNSPKVGVDVGPQTMGLFPDA 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10869NP_608605.1 DUF4795 378..562 CDD:292662 37/196 (19%)
CG10589NP_649269.1 DUF4795 75..288 CDD:292662 51/272 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CV14
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.