DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or94b

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:362 Identity:79/362 - (21%)
Similarity:145/362 - (40%) Gaps:60/362 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FIL-LPISVSVEYIQRFKTFSAGEFLSSIQIGVNMYGS----SFKSYLTMMGYKKRQEAKMSLDE 119
            |:| ||::.:...:..::..::.:|..:.|:   :|.|    :..:.|..:.| :|.||...:.|
  Fly    43 FVLHLPLTFTYIALMWYEAITSSDFEEAGQV---LYMSITELALVTKLLNIWY-RRHEAASLIHE 103

  Fly   120 L--DKRCVCDEERTIVHRHVALGNFCYIFYHIAYTSFLIS--NFLSFIMKRIHAWRMYFPYVDP- 179
            |  |..........|........||..|||...:.|..::  .::|...:  ..:.:.|.|..| 
  Fly   104 LQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWYIWGSLFVAVMGYISVFFQ--EDYELPFGYYVPF 166

  Fly   180 -----EKQFYISSIAEVILRGW---AVFMDLCTDVCPLISMVI---ARC----HIT----LLKQR 225
                 |:.||          .|   .|.|.||   |  :|.::   ..|    ||.    ||..|
  Fly   167 EWRTRERYFY----------AWGYNVVAMTLC---C--LSNILLDTLGCYFMFHIASLFRLLGMR 216

  Fly   226 ---LRNLRSEPGRTEDEYLKELADCVRDHRLILDYVDALRS--VFSGTIFVQFLLIGIVLGLSMI 285
               |:|...|..|.|...:.:|...||  ||..: .:.|.|  |.|..:|..|::  ......::
  Fly   217 LEALKNAAEEKARPELRRIFQLHTKVR--RLTRE-CEVLVSPYVLSQVVFSAFII--CFSAYRLV 276

  Fly   286 NIMFFSTLSTGVAVVLFMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYF 350
            ::.|.......|..|.|::.:.:|.|..||..|.:......:.:|:|.::|.......:..|..:
  Fly   277 HMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCY 341

  Fly   351 LHNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVTIV 387
            :..|::|:.:.||..|.|.:...:..:..|::...::
  Fly   342 MEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 74/332 (22%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 74/331 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466104
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.