DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or85e

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:222 Identity:49/222 - (22%)
Similarity:91/222 - (40%) Gaps:33/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 ISSIAEVILRGWAVFMDLCTDVCPLISMVIARCHITLLKQRLRNLRSEPGR----TEDEYLKELA 245
            :||:.|.:|.|        .....|...|:.:.|.|.|      ||...||    ..:.:...|.
  Fly   262 LSSLQEELLLG--------DSKRELNQYVLLQEHPTDL------LRLSAGRKCPDQGNAFHNALV 312

  Fly   246 DCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVL-------FM 303
            :|:|.||.||.....|.::||....|:.|.|...|.|    ::|...  :|...||       ::
  Fly   313 ECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLCL----LVFVGV--SGTREVLRIVNQLQYL 371

  Fly   304 SCVSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPI 368
            .....:...|.|...::........|:.::..|.......:..::.||.|.::.:.:|||..:.:
  Fly   372 GLTIFELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVM 436

  Fly   369 SMQTNLNMVKLAFTVVTIVKQFNLAEK 395
            .:....:::..||:.:|::::  ||.|
  Fly   437 DVNRLRSVITQAFSFLTLLQK--LAAK 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 43/206 (21%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 43/206 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.