DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or85d

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:418 Identity:79/418 - (18%)
Similarity:161/418 - (38%) Gaps:64/418 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKEKPLSERVKSRDAFVYLDRVMWSFGWTVPENK---RWD---LHYKLWSTFVTL-------LIF 60
            :|..||...:|..:.| ||     |.|....::|   :|.   ||:...:..|.|       ||:
  Fly    16 LKAIPLHSFLKYANVF-YL-----SIGMMAYDHKYSQKWKEVLLHWTFIAQMVNLNTVLISELIY 74

  Fly    61 ILLPISVSVEYIQRFKTFSAGEFLSSIQIGVNMYGSSFKSYLTMMGYKKRQEAKMSLDELDKRCV 125
            :.|.|.....:::.....|   |:..:.:|      .||.:......|:..:....|:||..:.:
  Fly    75 VFLAIGKGSNFLEATMNLS---FIGFVIVG------DFKIWNISRQRKRLTQVVSRLEELHPQGL 130

  Fly   126 CDEERTIVHRHVALGNFCYIFYHIAYTSFLISNFLSFIMKRIHAWRMYF---------------- 174
            ..:|...:..|::        .:..|:.|.....:..|......|.:|:                
  Fly   131 AQQEPYNIGHHLS--------GYSRYSKFYFGMHMVLIWTYNLYWAVYYLVCDFWLGMRQFERML 187

  Fly   175 PYV-------DPEKQFYISSIAEVILRGWAVFMDLCTD--VCPLISMVIARCHITLLKQRLRNLR 230
            ||.       .....:|...|::.|.....:...|..|  :|.|:::|:  .|...|...:.:..
  Fly   188 PYYCWVPWDWSTGYSYYFMYISQNIGGQACLSGQLAADMLMCALVTLVV--MHFIRLSAHIESHV 250

  Fly   231 SEPGRTEDEYLKELADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLST 295
            :..|..:.: |:.|...|..|:.::.....:..:|..::...|:....::......:...|.:..
  Fly   251 AGIGSFQHD-LEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICFVGFQMTIGSKIDN 314

  Fly   296 GVAVVLFMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIIL 360
            .|.:|||:.|..:|.|........::|..:::..:::..||..||.||:..|:..:...|||..|
  Fly   315 LVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRKMLILIIKRAQQPSRL 379

  Fly   361 TAGGVFPISMQTNLNMVKLAFTVVTIVK 388
            .|.....||:.|..::::|::....:::
  Fly   380 KATMFLNISLVTVSDLLQLSYKFFALLR 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 59/324 (18%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 60/335 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.