DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or83a

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:490 Identity:107/490 - (21%)
Similarity:192/490 - (39%) Gaps:133/490 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSQFFPHIKEKPLSERVKSRDAFVYLDR-----VMWSFGWTVPEN-------KRWDLHYKLWST 53
            |.|.|    ||:.:.:..|.||.||::.:     .|:.||:.|..:       :..||.|:|::.
  Fly     1 MKSTF----KEERIKDDSKRRDLFVFVRQTMCIAAMYPFGYYVNGSGVLAVLVRFCDLTYELFNY 61

  Fly    54 FVTLLIFILLPISVSVEYIQRFKTFSAGEFLSSI----QIGVNMYGSSFK--------------- 99
            ||::.|..|...::.:.|.|....|.....:.:|    .|.:.:|...|:               
  Fly    62 FVSVHIAGLYICTIYINYGQGDLDFFVNCLIQTIIYLWTIAMKLYFRRFRPGLLNTILSNINDEY 126

  Fly   100 --------SYLTMMGYKKRQEAKMSLDELDKRCVCDEERTIVHRHVALGNFCYIFYHIAYTSFLI 156
                    |::||.|     ..:||...:.....|          ..:|...::...|||....:
  Fly   127 ETRSAVGFSFVTMAG-----SYRMSKLWIKTYVYC----------CYIGTIFWLALPIAYRDRSL 176

  Fly   157 SNFLSFIMKRIHAWRMY-FPYVDP---EKQFYISSIAEV-ILRGWAVFMDLCTDVCPLI------ 210
            .         :..|  | |.|..|   |..|.:.::.:: :...:|....|...:|.||      
  Fly   177 P---------LACW--YPFDYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDV 230

  Fly   211 -----------SMVIARCHITLLKQRLRNLRS----EPGR-----TEDEYLKEL----------- 244
                       |.|:...::|.|.| |:..:|    |||:     .|:..|:||           
  Fly   231 LFCSLKNVLASSYVLMGANMTELNQ-LQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSS 294

  Fly   245 ------ADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVLFM 303
                  ..|::.||.|:..:..:.|.:|...||:   ||.|..| |..:.|.||.||  |...||
  Fly   295 AFRLSFVRCIQHHRYIVAALKKIESFYSPIWFVK---IGEVTFL-MCLVAFVSTKST--AANSFM 353

  Fly   304 SCVSM---------QTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPII 359
            ..||:         :.|..||..:::..:.|...::|::|.|....:..:|..::|:.|.::...
  Fly   354 RMVSLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQ 418

  Fly   360 LTAGGVFPISMQTNLNMVKLAFTVVTIVKQFNLAE 394
            ||||.:..:::......:..||:.:|::::.:..|
  Fly   419 LTAGKISNLNVDRFRGTITTAFSFLTLLQKMDARE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 78/383 (20%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 68/312 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.