DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or67a

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster


Alignment Length:333 Identity:68/333 - (20%)
Similarity:132/333 - (39%) Gaps:73/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 FLSSIQIGVNMYGSSFKSYLTMMGYKKRQE-------AKM----SLDELDKRCVCDEERTIVHRH 136
            ::|.:.:|::..|:..|....|....::.|       ||:    ::....|||           |
  Fly    85 YVSFVVMGLSKIGAVMKKKPKMTALVRQLETCFPSPSAKVQEEYAVKSWLKRC-----------H 138

  Fly   137 VALGNFCYIFYHIAYTSFLISNFLSFIMK---------------RIHAWR-----MYFPYVDPEK 181
            :....|..:|..:.:...||..|:.||.:               ::..|.     :::|     .
  Fly   139 IYTKGFGGLFMIMYFAHALIPLFIYFIQRVLLHYPDAKQIMPFYQLEPWEFRDSWLFYP-----S 198

  Fly   182 QFYISSIAEVILRGWAVFMDLCTDVCPLISMVIARCHITLLKQRLRNLRSEP-----GRTEDEYL 241
            .|:.||.......| ::..||.  :..::..||  .|...|.:.||..:.:.     |..||  :
  Fly   199 YFHQSSAGYTATCG-SIAGDLM--IFAVVLQVI--MHYERLAKVLREFKIQAHNAPNGAKED--I 256

  Fly   242 KELADCVRDHRLILDYVDALRSVFSGTIFVQFL-------LIGIVLGLSMINIMFFSTLSTGVAV 299
            ::|...|.:|..||...|.:..||...:.:.|:       |:|:.|.:::....|...:      
  Fly   257 RKLQSLVANHIDILRLTDLMNEVFGIPLLLNFIASALLVCLVGVQLTIALSPEYFCKQM------ 315

  Fly   300 VLFMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGG 364
             ||:..|.::.:..|.....::|..:.:..:.:..||..:|:|:|..|::.....|:|:.|.|..
  Fly   316 -LFLISVLLEVYLLCSFSQRLIDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATV 379

  Fly   365 VFPISMQT 372
            |..:||.|
  Fly   380 VLDLSMPT 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 68/333 (20%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 68/333 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.