DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or56a

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:202 Identity:37/202 - (18%)
Similarity:88/202 - (43%) Gaps:36/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LISMVIARCHITLLKQRL---RNLRSEPGRTEDEYLKELADCVRDHRLILDYVDALRSVFSGTIF 270
            :::..:....||.|..:|   |...||....:.:..||.   |::...|..:|..|:.:....:.
  Fly   235 ILNKRVEEMDITRLNSKLVIGRLTASELTFWQMQLFKEF---VKEQLRIRKFVQELQYLICVPVM 296

  Fly   271 VQFLLIGIVLGLSMINIMFFSTLSTGVAVVL--FMSCVSMQTFPFCYL-------------CNMI 320
            ..|::..:     :|..:||: |:.||...:  |        |.|.||             ..:|
  Fly   297 ADFIIFSV-----LICFLFFA-LTVGVPSKMDYF--------FMFIYLFVMAGILWIYHWHATLI 347

  Fly   321 MDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVT 385
            ::...|::.:.|...|.:.:...:..||:.:.:.|:|:.:.| .:..::::|.:::.:.|::...
  Fly   348 VECHDELSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRA-LLVDLNLRTFIDIGRGAYSYFN 411

  Fly   386 IVKQFNL 392
            :::..:|
  Fly   412 LLRSSHL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 35/189 (19%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 35/189 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.