DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or49b

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:209 Identity:42/209 - (20%)
Similarity:97/209 - (46%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 WAVFMDLCTDV--C---PLISMV-------IARCHITLLKQRLRN--LRSEPG-RTEDEYLKELA 245
            |.:|..|.|.:  |   |..|::       |.||  ..|:.|||.  |:...| |...|..:|:.
  Fly   166 WYIFQMLITPMGCCMYIPYTSLIVGLIMFGIVRC--KALQHRLRQVALKHPYGDRDPRELREEII 228

  Fly   246 DCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVLFMSCVSMQT 310
            .|:|..:.|::|:|.:..:.:.....:.:....:|...:..::..|..|..:.|.::::.:..|.
  Fly   229 ACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILAQI 293

  Fly   311 FPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLN 375
            ....:..|.:.:....:|.:.::::|.:.|...:..:::.:...|:|..:..|.:.||:::...|
  Fly   294 LALYWYANELREQNLAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQN 358

  Fly   376 MVKLAFTVVTIVKQ 389
            ::...:|..|::|:
  Fly   359 LLNTTYTFFTVLKR 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 39/199 (20%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 39/199 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.