DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or45b

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:412 Identity:82/412 - (19%)
Similarity:152/412 - (36%) Gaps:95/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WSF---GWTVPENKRWDLHYKLWSTFVTLLIFILLPISVSVEYIQRFKTFSAGEFLSSIQIGVNM 93
            :||   |....:.:.| ||. ||..|    .|:.|......|::     |......:|....::.
  Fly    22 YSFGLLGLRFGKEQSW-LHL-LWLVF----NFVNLAHCCQAEFV-----FGWSHLRTSPVDAMDA 75

  Fly    94 YGSSFKSYLTM--MGYK--KRQEA-------KMSLDELDKRCVCDEERTIVHRHVAL-----GNF 142
            :.....|:.|:  :|:.  :|||.       ::.:.|.:||  .|..|.:..|...|     |..
  Fly    76 FCPLACSFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKR--EDSRRKVAQRSYYLMVTRCGML 138

  Fly   143 CYIFYHIAYTSFLISNFLSFIMKR-------------IH--AWRM-YFPYVDPEKQFYISSI--- 188
            .:....|...:|::.:.....::|             .|  |.|| :||.      ||:.|.   
  Fly   139 VFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPV------FYLYSTWSG 197

  Fly   189 ---------AEVILRGWAVFMDLCTDVCPLISMVIARCHITLLKQRLR-NLRSEPGRTEDEYLKE 243
                     .:....|:.::|                   ..|.|.|| :::.......|..|:|
  Fly   198 QVTVYAFAGTDGFFFGFTLYM-------------------AFLLQALRYDIQDALKPIRDPSLRE 243

  Fly   244 -------LADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVL 301
                   |||.|..|..|...|.....:.:...||.|:...:|:..|:|:|:.:|..:. :..|:
  Fly   244 SKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYNI-IRYVV 307

  Fly   302 FMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVF 366
            :...||...|.:||....:..:...:.::.:.|.|.:.||..:..:...:...|:||.:.. ..|
  Fly   308 YTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRV-PFF 371

  Fly   367 PISMQTNLNMVKLAFTVVTIVK 388
            ..|:....:::|...::|.:.|
  Fly   372 APSLPVFTSVIKFTGSIVALAK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 67/351 (19%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 67/346 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.