DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or43b

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster


Alignment Length:400 Identity:138/400 - (34%)
Similarity:221/400 - (55%) Gaps:13/400 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FPHIK---EKPLSERVKSRDAFVYLDRVMWSFGWTVPENKRWDLHYKLWSTFVTLLIFILLPISV 67
            |.|.|   ..|:||.::|||:..|:...:.:.|..:..:  :.:..|:|..|......::||:|.
  Fly     2 FGHFKLVYPAPISEPIQSRDSNAYMMETLRNSGLNLKND--FGIGRKIWRVFSFTYNMVILPVSF 64

  Fly    68 SVEYIQRFKTFSAGEFLSSIQIGVNMYGSSFKSYLTMMGYKKRQE-AKMSLDELDKRCVCDEERT 131
            .:.|:.....|.....|.|:|:.:|.:..:.| :.|::.|..|.| |....|||||.||...|:.
  Fly    65 PINYVIHLAEFPPELLLQSLQLCLNTWCFALK-FFTLIVYTHRLELANKHFDELDKYCVKPAEKR 128

  Fly   132 IVHRHVALGNFCYIFYHIAYTSFLISNFLSFIMKRIHAWRMYFPYVD---PEKQFYISSIAEVIL 193
            .|...||.....|:.:.:.|..:..|..|..::.....:..|:|:::   ...|.||.|..|...
  Fly   129 KVRDMVATITRLYLTFVVVYVLYATSTLLDGLLHHRVPYNTYYPFINWRVDRTQMYIQSFLEYFT 193

  Fly   194 RGWAVFMDLCTDVCPLISMVIARCHITLLKQRLRNL--RSEPGRTEDEYL-KELADCVRDHRLIL 255
            .|:|:::...||..|:|.:...|.||.|||.|:..|  .|..|.::..|: |.|.||::.||.:|
  Fly   194 VGYAIYVATATDSYPVIYVAALRTHILLLKDRIIYLGDPSNEGSSDPSYMFKSLVDCIKAHRTML 258

  Fly   256 DYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVLFMSCVSMQTFPFCYLCNMI 320
            ::.||::.:.|||||.||::.|.:||:.|||::.|:..||...:|:::..|.:||||.|:.||.|
  Fly   259 NFCDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRFGIVIYVMAVLLQTFPLCFYCNAI 323

  Fly   321 MDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVT 385
            :|||:|:|.:||.|.|...|:||:.|::.||..||||:..||..:|.|::.||:|:.|.||||..
  Fly   324 VDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLATNINVAKFAFTVYA 388

  Fly   386 IVKQFNLAEK 395
            |....||.:|
  Fly   389 IASGMNLDQK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 111/306 (36%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 107/289 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468556
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.