DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or24a

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:411 Identity:86/411 - (20%)
Similarity:155/411 - (37%) Gaps:107/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PENKRWDLHYKLWSTFVTLLIFIL--------------LPISVSVEYIQRFKTFSAGEFLSSIQ- 88
            ||.||..| .||||.|   ..|||              :||:::.........  |...||.:: 
  Fly    31 PEQKRTVL-VKLWSFF---NFFILTYGCYAEAYYGIHYIPINIATALDALCPV--ASSILSLVKM 89

  Fly    89 IGVNMYGSSFKS------YLT-------MMGYKKRQEAKMSLDELDKRCVCDEERTIVHRHVALG 140
            :.:..|....:|      :||       .:|||||.....:  :|....:|             .
  Fly    90 VAIWWYQDELRSLIERVRFLTEQQKSKRKLGYKKRFYTLAT--QLTFLLLC-------------C 139

  Fly   141 NFCYIFYHIAYTSFLISNFLSFIMKRIHA--W------RMYFP------------YVDPEKQFYI 185
            .||      ..||:.:.:.:..|::|.|.  |      :|.||            |:......||
  Fly   140 GFC------TSTSYSVRHLIDNILRRTHGKDWIYETPFKMMFPDLLLRLPLYPITYILVHWHGYI 198

  Fly   186 SSIAEVILRGWAVFMDLC-----------TDVCPLISMVIARCHITLLKQRLRNLRSEPGRTED- 238
            :.:..|...|:  |:..|           .|||.|:              .:.|:...|...|: 
  Fly   199 TVVCFVGADGF--FLGFCLYFTVLLLCLQDDVCDLL--------------EVENIEKSPSEAEEA 247

  Fly   239 EYLKELADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVLFM 303
            ..::|:...|..|..:.:..:.|..|........|:...:::|.|:::|:.||.|  |:.|.:..
  Fly   248 RIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLFSGL--GIIVYVVY 310

  Fly   304 SC-VSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFP 367
            :| |.::.|.:|...:.||:.|..:|.|.|.|.|.....|.:...:..:...|:.:.:.. ..|.
  Fly   311 TCAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKI-PFFS 374

  Fly   368 ISMQTNLNMVKLAFTVVTIVK 388
            .|::|..::::...:::.:.|
  Fly   375 PSLETLTSILRFTGSLIALAK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 69/346 (20%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 70/361 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.